Protein detail
SIG10
Sialic acid-binding Ig-like lectin 10 (Siglec-10) (Siglec-like protein 2)
Entry name SIG10 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Sialic acid-binding Ig-like lectin 10 (Siglec-10) (Siglec-like protein 2)
Protein Class (2)
Predicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
551..571; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
MGC126774PRO940SIGLEC-10SLG2
Gene Description
Sialic acid binding Ig like lectin 10
Chromosome
19
Position
51410020-51417803
Supporting publications (n)
1
EVMP confidence score
0.38
Function & Pathway8
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (5)
Biological Process (3)
Reactome (2)
Canonical Pathways (3)
- M31 Pid beta catenin deg pathway
- M90 Pid wnt canonical pathway
- M184 Pid ecadherin keratinocyte pathway
Mediation Categories
Immune mediation
Relations & Evidence56
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SIGLEC10 | LCK | P06239 | Y | 691 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | LCK | P06239 | Y | 667 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | LCK | P06239 | Y | 597 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | JAK3 | P52333 | Y | 691 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | JAK3 | P52333 | Y | 667 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | JAK3 | P52333 | Y | 597 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | ITK | Q08881 | Y | 667 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | ITK | Q08881 | Y | 597 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| SIGLEC10 | ITK | Q08881 | Y | 691 | phosphorylation | PhosphoNetworks | |
| SIGLEC10 | FYN | P06241 | Y | 667 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ITK | Q08881 | SIG10 | Q96LC7 | Yes | Yes | No | WangPhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002KEA:11733002phosphoELM:11733002PhosphoSite:12163025ProtMapper:11733002 |
| JAK3 | P52333 | SIG10 | Q96LC7 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002ProtMapper:11733002 |
| LCK | P06239 | SIG10 | Q96LC7 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11733002phosphoELM:11733002KEA:11733002PhosphoSite:11733002ProtMapper:11733002 |
Protein Complex Composition (1)
Sequence, Structure & Domains12
Sequences
Length
697
Mass
76,592
Sequence
MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHPWGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHEGEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ
Alternative Products
Event=Alternative splicing; Named isoforms=9; Name=1; Synonyms=Long; IsoId=Q96LC7-1; Sequence=Displayed; Name=2; Synonyms=Short, Sv1; IsoId=Q96LC7-2; Sequence=VSP_002565; Name=3; Synonyms=Sv3; IsoId=Q96LC7-3; Sequence=VSP_002564; Name=4; Synonyms=Sv4; IsoId=Q96LC7-4; Sequence=VSP_002561; Name=5; Synonyms=Sv2; IsoId=Q96LC7-5; Sequence=VSP_002562, VSP_002563; Name=6; IsoId=Q96LC7-6; Sequence=VSP_002564, VSP_002565; Name=7; IsoId=Q96LC7-7; Sequence=VSP_045365, VSP_002565; Name=8; IsoId=Q96LC7-8; Sequence=VSP_002564, VSP_045853, VSP_045854, VSP_002565; Name=9; IsoId=Q96LC7-9; Sequence=VSP_045888, VSP_002565
Alternative Sequence
125..214; Missing (in isoform 4); 140..185; TALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAAL -> TGMRWGGNPCLSHWGGTLGTAYGLSREGSQGPLQHKNLPPRSLSQP (in isoform 5); 141..198; Missing (in isoform 3, isoform 6 and isoform 8); 141..188; Missing (in isoform 7); 146..228; Missing (in isoform 9); 186..697; Missing (in isoform 5); 252; A -> D (in isoform 8); 253..342; Missing (in isoform 8); 445..539; Missing (in isoform 2, isoform 6, isoform 7, isoform 8 and isoform 9)
Domain & Motif Annotations
Compositional Bias
620..629; Pro residues; 650..659; Polar residues
Motif
595..600; ITIM motif 1; 665..670; ITIM motif 2
Domain (CC)
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
18..121; Ig-like V-type; 146..231; Ig-like C2-type 1; 251..339; Ig-like C2-type 2; 344..441; Ig-like C2-type 3
Region
606..697; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- SIGLEC (sialic acid binding Ig-like lectin) family
Sequence Similarities
Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 28211531 | Proteomic analysis of urinary extracellular vesicles from high Gleason score prostate cancer. | No abstract available |