Protein detail
FCRL3
Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (MAIA) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)
Protein symbol FCRL3 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification CD markersDisease related genesPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
Fc receptor-like protein 3 (FcR-like protein 3) (FcRL3) (Fc receptor homolog 3) (FcRH3) (IFGP family protein 3) (hIFGP3) (Immune receptor translocation-associated protein 3) (MAIA) (SH2 domain-containing phosphatase anchor protein 2) (CD antigen CD307c)
Protein Class
CD markersDisease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- Disease related genes
- CD markers
- Predicted intracellular proteins
Transmembrane
574..594; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD307cFCRH3IFGP3IRTA3SPAP2SPAP2aSPAP2bSPAP2cSPAP2dSPAP2e
Gene Description
Fc receptor like 3
Chromosome
1
Position
157674321-157700769
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Brain Regional Specificcerebral cortexCell SpecificAdrenal medulla cellsSecretome LocationIntracellular and membraneSecretome FunctionCell adhesion
Function & Pathway
Protein Function
- Disease related genes
- CD markers
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Mediation Categories
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FCRL3 | SRC | P12931 | Y | 722 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| FCRL3 | SRC | P12931 | Y | 662 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| FCRL3 | SRC | P12931 | Y | 692 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| FCRL3 | SRC | P12931 | Y | 650 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling
31 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| SRC | P12931 | FCRL3 | Q96P31 | Yes | Yes | No | PhosphoSite_MIMPMIMPPhosphoSite_norefSIGNORiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:12051764SIGNOR:12051764 |
| FCRL3 | Q96P31 | PTN6 | P29350 | Yes | Yes | No | SIGNOR | SIGNOR:12051764 |
| FCRL3 | Q96P31 | ZAP70 | P43403 | Yes | Yes | No | HPRDNetPathSIGNOR | HPRD:12051764NetPath:12051764SIGNOR:12051764 |
| FCRL3 | Q96P31 | PTN11 | Q06124 | Yes | Yes | No | SIGNOR | SIGNOR:12051764 |
| FCRL3 | Q96P31 | KSYK | P43405 | Yes | Yes | No | SIGNOR | SIGNOR:12051764 |
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryMass spectrometry [LTQ-FT Ultra]Small R sequencing (Illumi HiSeq 2000 (Solexa) | 1 | 22329422 |
Sequence, Structure & Domains
Sequences
Length
734
Mass
80,856
Sequence
MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHDKIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQLPNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQVQELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQRVPVSNVNLEIRPTGGQLIEGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKESDAGRYYCAADNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTLRAPGAQAVVGDLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTLNVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARARRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEENYENVPRVLLASDH
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=Spap2a; IsoId=Q96P31-1; Sequence=Displayed; Name=2; Synonyms=Spap2b; IsoId=Q96P31-2; Sequence=VSP_033300; Name=3; Synonyms=Spap2c; IsoId=Q96P31-3; Sequence=VSP_033305; Name=4; Synonyms=Spap2d; IsoId=Q96P31-4; Sequence=VSP_033301, VSP_033303; Name=5; IsoId=Q96P31-5; Sequence=VSP_033302, VSP_033304; Name=6; IsoId=Q96P31-6; Sequence=VSP_033308; Name=7; IsoId=Q96P31-7; Sequence=VSP_033306, VSP_033307
Alternative Sequence
187..282; ELFLHPVLRASSSTPIEGSPMTLTCETQLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRVQR -> G (in isoform 2); 187..189; ELF -> GNG (in isoform 4); 188..199; LFLHPVLRASSS -> ARCPAAILPLQR (in isoform 5); 190..734; Missing (in isoform 4); 200..734; Missing (in isoform 5); 378; I -> TLLSPSV (in isoform 3); 698..707; THPDDSAGEA -> EQSSRFSMSL (in isoform 7); 708..734; Missing (in isoform 7); 725..734; VPRVLLASDH -> ILNPRKNKVQDFPCLCNT (in isoform 6)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
608..627; Polar residues; 628..637; Basic and acidic residues
Motif
648..653; ITIM motif 1; 660..665; ITIM motif 2; 690..695; ITIM motif 3; 720..725; ITIM motif 4
Domain (FT)
21..98; Ig-like C2-type 1; 99..182; Ig-like C2-type 2; 192..270; Ig-like C2-type 3; 284..369; Ig-like C2-type 4; 383..470; Ig-like C2-type 5; 476..563; Ig-like C2-type 6
Region
603..655; Disordered; 695..734; Disordered
Clinical Relevance
Antibody