Protein detail
S22AC
Solute carrier family 22 member 12 (Organic anion transporter 4-like protein) (Renal-specific transporter) (RST) (Urate anion exchanger 1) (URAT1) (Urate:anion antiporter SLC22A12)
Protein symbol S22AC | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count 12 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Solute carrier family 22 member 12 (Organic anion transporter 4-like protein) (Renal-specific transporter) (RST) (Urate anion exchanger 1) (URAT1) (Urate:anion antiporter SLC22A12)
Protein Class
Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Urinary system diseases:Kidney diseases
- FDA approved drug targets:Small molecule drugs
Transmembrane
9..29; Helical; 146..166; Helical; 174..194; Helical; 195..215; Helical; 232..252; Helical; 260..280; Helical; 351..371; Helical; 378..398; Helical; 407..427; Helical; 435..455; Helical; 466..486; Helical; 495..515; Helical
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym
OAT4LRSTURAT1
Gene Description
Solute carrier family 22 member 12
Chromosome
11
Position
64590641-64602353
EVMP Score
0.38
Fluorescence & Localization
Tissue Specifictestis
Function & Pathway
Protein Function
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Urinary system diseases:Kidney diseases
- FDA approved drug targets:Small molecule drugs
Cellular Component
Biological Process
Reactome
Mediation Categories
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| apical_cell_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
| cell_surface | cell_surface | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 34265469 |
Sequence, Structure & Domains
Sequences
Length
553
Mass
59,630
Sequence
MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSYLQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLGFSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAFGFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCILANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATHGTLGNSVLKSTQF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q96S37-1; Sequence=Displayed; Name=2; IsoId=Q96S37-2; Sequence=VSP_028879; Name=3; IsoId=Q96S37-3; Sequence=VSP_054054; Name=4; IsoId=Q96S37-4; Sequence=VSP_054055
Alternative Sequence
1..221; Missing (in isoform 3); 170..277; Missing (in isoform 2); 187..221; GTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLL -> V (in isoform 4)
3D Structural Models
Turn
124..126; 227..229
Helix
4..10; 15..36; 38..41; 52..55; 57..61; 69..76; 96..99; 105..107; 110..112; 131..135; 139..143; 144..170; 172..191; 196..223; 230..254; 258..266; 268..275; 276..278; 283..289; 292..305; 309..312; 317..328; 329..332; 337..342; 346..367; 371..374; 378..403; 405..425; 431..459; 462..485; 486..492; 495..512; 527..537
Beta Strand
12..14; 47..49; 83..85; 87..93; 100..102; 113..115; 120..122; 428..430; 519..521
3D Structure
Electron microscopy (24)
Domain & Motif Annotations
Protein Families
- Major facilitator (TC 2.A.1) superfamily
- Organic cation transporter (TC 2.A.1.19) family
Sequence Similarities
Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.
Clinical Relevance
Disease Involvement
Disease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Antibody