Protein detail
S22AC
Solute carrier family 22 member 12 (Organic anion transporter 4-like protein) (Renal-specific transporter) (RST) (Urate anion exchanger 1) (URAT1) (Urate:anion antiporter SLC22A12)
Entry name S22AC | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count 12 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
Solute carrier family 22 member 12 (Organic anion transporter 4-like protein) (Renal-specific transporter) (RST) (Urate anion exchanger 1) (URAT1) (Urate:anion antiporter SLC22A12)
Protein Class (6)
Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Urinary system diseases:Kidney diseases
- FDA approved drug targets:Small molecule drugs
Transmembrane
9..29; Helical; 146..166; Helical; 174..194; Helical; 195..215; Helical; 232..252; Helical; 260..280; Helical; 351..371; Helical; 378..398; Helical; 407..427; Helical; 435..455; Helical; 466..486; Helical; 495..515; Helical
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
OAT4LRSTURAT1
Gene Description
Solute carrier family 22 member 12
Chromosome
11
Position
64590641-64602353
EVMP confidence score
0.38
Fluorescence & Localization1
Tissue Specifictestis
Function & Pathway6
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Urinary system diseases:Kidney diseases
- FDA approved drug targets:Small molecule drugs
Cellular Component (5)
Molecular Function (2)
Biological Process (3)
Reactome (6)
Mediation Categories (2)
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence22
Ligand-Receptor Signaling (21)
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 3 of 3Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 34265469 |
Sequence, Structure & Domains11
Sequences
Length
553
Mass
59,630
Sequence
MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSIFTSTIVAKWNLVCDSHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSYLQMAVMGTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLLMEWTAARARPLVMTLNSLGFSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLAESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRTCISTLCWFAFGFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCILANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLVRLLGVHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATHGTLGNSVLKSTQF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q96S37-1; Sequence=Displayed; Name=2; IsoId=Q96S37-2; Sequence=VSP_028879; Name=3; IsoId=Q96S37-3; Sequence=VSP_054054; Name=4; IsoId=Q96S37-4; Sequence=VSP_054055
Alternative Sequence
1..221; Missing (in isoform 3); 170..277; Missing (in isoform 2); 187..221; GTAAAFAPAFPVYCLFRFLLAFAVAGVMMNTGTLL -> V (in isoform 4)
3D Structural Models
Turn
124..126; 227..229
Helix
4..10; 15..36; 38..41; 52..55; 57..61; 69..76; 96..99; 105..107; 110..112; 131..135; 139..143; 144..170; 172..191; 196..223; 230..254; 258..266; 268..275; 276..278; 283..289; 292..305; 309..312; 317..328; 329..332; 337..342; 346..367; 371..374; 378..403; 405..425; 431..459; 462..485; 486..492; 495..512; 527..537
Beta Strand
12..14; 47..49; 83..85; 87..93; 100..102; 113..115; 120..122; 428..430; 519..521
3D Structure
Electron microscopy (24)
Domain & Motif Annotations
Protein Families (2)
- Major facilitator (TC 2.A.1) superfamily
- Organic cation transporter (TC 2.A.1.19) family
Sequence Similarities
Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.
Clinical Relevance4
Disease Involvement (2)
Disease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs (13)
Antibody