Protein detail
KCNKH
Potassium channel subfamily K member 17 (2P domain potassium channel Talk-2) (Acid-sensitive potassium channel protein TASK-4) (TWIK-related acid-sensitive K(+) channel 4) (TWIK-related alkaline pH-activated K(+) channel 2) (TALK-2)
Entry name KCNKH | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 4 | Protein classification Predicted membrane proteinsTransportersVoltage-gated ion channels |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Potassium channel subfamily K member 17 (2P domain potassium channel Talk-2) (Acid-sensitive potassium channel protein TASK-4) (TWIK-related acid-sensitive K(+) channel 4) (TWIK-related alkaline pH-activated K(+) channel 2) (TALK-2)
Protein Class (3)
Predicted membrane proteinsTransportersVoltage-gated ion channels
Protein Function (2)
- Voltage-gated ion channels:Two-P Potassium Channels
- Transporters:Transporter channels and pores
Transmembrane
21..43; Helical; 128..148; Helical; 180..200; Helical; 244..264; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
K2p17.1TALK-2TALK2TASK-4TASK4
Gene Description
Potassium two pore domain channel subfamily K member 17
Chromosome
6
Position
39299001-39314461
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificblood vesselCell SpecificAlveolar cells type 1Single-Nuclei Brain Specificpericyte
Function & Pathway6
Protein Function (2)
- Voltage-gated ion channels:Two-P Potassium Channels
- Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (6)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence18
Ligand-Receptor Signaling (17)
17 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| two_pore_domain_potassium | ion_channel | HGNC | No | Yes | No | No | No |
| ion_channel | ion_channel | HGNC | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains9
Sequences
Length
332
Mass
36,895
Sequence
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96T54-3; Sequence=Displayed; Name=2; IsoId=Q96T54-4; Sequence=VSP_047354
Alternative Sequence
230..332; GMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS -> ASCLISDTRKPNRDWQTLERTSKSSGGLLKYRFLAGHGGSHL (in isoform 2)
Domain & Motif Annotations
Domain (CC)
The pore-forming domains 1 and 2 assemble to form a single pore in which M2 and M4 transmembrane helices line the central cavity and M1 and M3 face the lipid bilayer. The transmembrane helices are bridged by the selectivity filters 1 and 2 carrying a signature sequence TxTTxGYGD that coordinate the permeant ions. Up to four ions can simultaneously occupy the selectivity filter and at least two elementary charges must translocate across the filter to convert it into the open conformation.
Region
116..121; Selectivity filter 1; 221..226; Selectivity filter 2; 287..312; Disordered
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Sequence Similarities
Belongs to the two pore domain potassium channel (TC 1.A.1.8) family.
Clinical Relevance1
Antibody
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |