Protein detail
CYH2
Cytohesin-2 (ARF exchange factor) (ARF nucleotide-binding site opener) (Protein ARNO) (PH, SEC7 and coiled-coil domain-containing protein 2)
Entry name CYH2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cytohesin-2 (ARF exchange factor) (ARF nucleotide-binding site opener) (Protein ARNO) (PH, SEC7 and coiled-coil domain-containing protein 2)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
ARNOCTS18.1cytohesin-2PSCD2PSCD2LSec7p-LSec7p-like
Gene Description
Cytohesin 2
Chromosome
19
Position
48469208-48482314
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificAdipocytesSingle-Nuclei Brain Specificupper rhombic lip
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (8)
Molecular Function (4)
Biological Process (3)
KEGG (5)
Reactome (4)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence27
Enzyme-Mediated Modification (9)
9 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CYTH2 | PRKCA | P17252 | S | 392 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:10531036phosphoELM:10531036KEA:10531036HPRD:10531036KEA:17570479ProtMapper:10531036 |
| CYTH2 | PRKCA | P17252 | S | 391 | phosphorylation | HPRDKEA | HPRD:10531036KEA:10531036 |
| CYTH2 | PRKCG | P05129 | S | 392 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | SIGNOR:10531036ProtMapper:10531036HPRD:10531036KEA:10531036 |
| CYTH2 | PRKCG | P05129 | S | 391 | phosphorylation | HPRDKEA | HPRD:10531036KEA:10531036 |
| CYTH2 | PRKCB | P05771 | S | 392 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | SIGNOR:10531036ProtMapper:10531036HPRD:10531036KEA:10531036 |
| CYTH2 | PRKCB | P05771 | S | 391 | phosphorylation | HPRDKEA | HPRD:10531036KEA:10531036 |
| CYTH2 | AKT1 | P31749 | T | 276 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CYTH2 | PRKCD | Q05655 | S | 392 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| CYTH2 | PRKCE | Q02156 | S | 392 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| adhesion | adhesion | MCAM | Yes | Yes | |||
| adhesion | adhesion | OmniPath | Yes | Yes | |||
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | |||
| tight_junction | tight_junction | Zhong2015 | Yes | Yes | |||
| tight_junction | tight_junction | OmniPath | Yes | Yes |
Page 1 of 2Next
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | CYH2 | Q99418 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperNetworKIN_KEAphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteAdhesomeHPRD-phos | Adhesome:10531036PhosphoSite:10531036SIGNOR:10531036phosphoELM:10531036PhosphoSite:18042453KEA:10531036PhosphoSite:24303080PhosphoSite:24083777HPRD-phos:10531036HPRD:10531036KEA:17570479ProtMapper:10531036PhosphoSite:20153292 | |
| KPCB | P05771 | CYH2 | Q99418 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | SIGNOR:10531036KEA:10531036HPRD-phos:10531036HPRD:10531036ProtMapper:10531036 | |
| CYH2 | Q99418 | ARF6 | P62330 | Yes | Yes | WangKEGG-MEDICUSSIGNORHPRDHINTBioGRIDSPIKE_LC | HINT:17846866HINT:9417041HPRD:9417041BioGRID:9417041SIGNOR:14565977SPIKE_LC:16189514 | |
| KPCG | P05129 | CYH2 | Q99418 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | SIGNOR:10531036KEA:10531036HPRD-phos:10531036HPRD:10531036ProtMapper:10531036 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 34265469 |
Sequence, Structure & Domains
Sequences
Length
400
Mass
46,546
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99418-1; Sequence=Displayed; Name=2; IsoId=Q99418-2; Sequence=VSP_006036
Alternative Sequence
272; Missing (in isoform 2)
3D Structural Models
Turn
217..220
Helix
63..74; 76..85; 93..102; 108..115; 120..131; 140..149; 157..174; 182..200; 210..216; 228..240
Beta Strand
178..180; 221..224
3D Structure
X-ray crystallography (11)
Domain & Motif Annotations
Coiled Coil
10..63
Domain (CC)
Binds via its PH domain to the inositol head group of phosphatidylinositol 3,4,5-trisphosphate. The PH domain is necessary and sufficient for plasma membrane relocalization.; DOMAIN: Autoinhibited by its C-terminal basic region.; DOMAIN: The coiled coil domain is involved in interaction with CCDC120..
Domain (FT)
72..201; SEC7; 259..376; PH
Region
387..395; C-terminal autoinhibitory region
Clinical Relevance
Drugs
Interaction Protein (5)
ENSG00000074706ENSG00000128271ENSG00000142675ENSG00000147144ENSG00000163362
Interaction Count
5
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 28211531 | Proteomic analysis of urinary extracellular vesicles from high Gleason score prostate cancer. | No related sentences available |