Protein detail

S10AD

Protein S100-A13 (S100 calcium-binding protein A13)

Entry name S10AD	UniProt ID Q99584	EVMP confidence score 0.38
Supporting publications (n) 3	Transmembrane count	Protein classification Predicted intracellular proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Protein S100-A13 (S100 calcium-binding protein A13)

Protein Class (2)

Predicted intracellular proteinsPredicted secreted proteins

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Ensembl

ENSG00000189171

Entrez Gene Symbol

S100A13

Gene Description

S100 calcium binding protein A13

Chromosome

Position

153618787-153631360

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Tissue Specificstomach 1Cell SpecificFoveolar cellsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway6

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Cellular Component (9)

Molecular Function (9)

Biological Process (3)

KEGG

hsa04382 Cornified envelope formation

Mediation Categories (3)

Fusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence22

Ligand-Receptor Signaling (15)

15 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	LOCATE	No	No	Yes	No	No
intracellular	intracellular	ComPPI	No	No	Yes	No	No
intracellular	intracellular	GO_Intercell	No	No	Yes	No	No
intracellular	intracellular	UniProt_location	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
growth_factor_binder	ligand_regulator	GO_Intercell	Yes	No	Yes	No	No
ligand_regulator	ligand_regulator	OmniPath	Yes	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No

Page 1 of 2Next

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
IL1A S100A13	P01583 Q99584	2:2	PDB	PDB:2l5x
FGF1 S100A13 SYT1	P05230 P21579 Q99584	2:2:2	PDB	PDB:2ki6
FGF1 S100A13	P05230 Q99584	2:2	PDB	PDB:2ki4
S100A13 SYT1	P21579 Q99584	2:2	PDB	PDB:2k8m
S100A13 STK4	Q13043 Q99584	0:0	Havugimana2012	Havugimana2012:C_32
S100A13	Q99584	2	PDB	PDB:1yuuPDB:1yurPDB:1yutPDB:2egdPDB:1yusPDB:2kotPDB:2h2k

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Western BlottingMass SpectrometryFlow CytometryElisa	1	37438638

Sequence, Structure & Domains10

Sequences

Length

Mass

11,471

Sequence

MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK

3D Structural Models

Turn

47..52

Helix

1..3; 8..24; 35..45; 56..63; 73..88; 93..95

Beta Strand

26..28; 32..34; 53..55; 67..72

3D Structure

NMR spectroscopy (10); X-ray crystallography (2)

Domain & Motif Annotations

Domain (FT)

18..53; EF-hand

Protein Families

S-100 family

Sequence Similarities

Belongs to the S-100 family.

Clinical Relevance1

Antibody (2)

HPA019592 CAB025494

Supporting Publications3

PMID	Title	Abstract
29603567	Involvement of serum-derived exosomes of elderly patients with bone loss in failure of bone remodeling via alteration of exosomal bone-related proteins.	No abstract available
32301581	Proteomic and biological profiling of extracellular vesicles from Alzheimer's disease human brain tissues.	Extracellular vesicles (EVs) from human Alzheimer's disease (AD) biospecimens contain amyloid beta (Aβ) peptide and tau.
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available