Protein detail
S10AD
Protein S100-A13 (S100 calcium-binding protein A13)
Entry name S10AD | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 3 | Transmembrane count | Protein classification Predicted intracellular proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein S100-A13 (S100 calcium-binding protein A13)
Protein Class (2)
Predicted intracellular proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
S100 calcium binding protein A13
Chromosome
1
Position
153618787-153631360
Supporting publications (n)
3
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificstomach 1Cell SpecificFoveolar cellsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (9)
Molecular Function (9)
Biological Process (3)
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence22
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | Matrisome | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| ligand | ligand | Matrisome | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes |
Page 2 of 2Previous
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| IL1AS100A13 | P01583Q99584 | 2:2 | PDB | PDB:2l5x | ||
| FGF1S100A13SYT1 | P05230P21579Q99584 | 2:2:2 | PDB | PDB:2ki6 | ||
| FGF1S100A13 | P05230Q99584 | 2:2 | PDB | PDB:2ki4 | ||
| S100A13SYT1 | P21579Q99584 | 2:2 | PDB | PDB:2k8m | ||
| S100A13STK4 | Q13043Q99584 | 0:0 | Havugimana2012 | Havugimana2012:C_32 | ||
| S100A13 | Q99584 | 2 | PDB | PDB:1yuuPDB:1yurPDB:1yutPDB:2egdPDB:1yusPDB:2kotPDB:2h2k |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western BlottingMass SpectrometryFlow CytometryElisa | 1 | 37438638 |
Sequence, Structure & Domains
Sequences
Length
98
Mass
11,471
Sequence
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
3D Structural Models
Turn
47..52
Helix
1..3; 8..24; 35..45; 56..63; 73..88; 93..95
Beta Strand
26..28; 32..34; 53..55; 67..72
3D Structure
NMR spectroscopy (10); X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
18..53; EF-hand
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Supporting Publications3
| PMID | Title | Related sentences |
|---|---|---|
| 29603567 | Involvement of serum-derived exosomes of elderly patients with bone loss in failure of bone remodeling via alteration of exosomal bone-related proteins. | No related sentences available |
| 32301581 | Proteomic and biological profiling of extracellular vesicles from Alzheimer's disease human brain tissues. | Extracellular vesicles (EVs) from human Alzheimer's disease (AD) biospecimens contain amyloid beta (Aβ) peptide and tau. |
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |