Protein detail
PD1L2
Programmed cell death 1 ligand 2 (PD-1 ligand 2) (PD-L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD antigen CD273)
Entry name PD1L2 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 3 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersPredicted membrane proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Programmed cell death 1 ligand 2 (PD-1 ligand 2) (PD-L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD antigen CD273)
Protein Class (4)
Cancer-related genesCD markersPredicted membrane proteinsPredicted secreted proteins
Protein Function (3)
- Predicted secreted proteins
- CD markers
- Cancer-related genes
Transmembrane
221..241; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
B7-DCbA574F11.2BtdcCD273PD-L2PDL2
Gene Description
Programmed cell death 1 ligand 2
Chromosome
9
Position
5510531-5571282
Supporting publications (n)
3
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificNeutrophilsSingle-Nuclei Brain Specificendothelial cellBlood Cell Specificneutrophil
Function & Pathway
Protein Function (3)
- Predicted secreted proteins
- CD markers
- Cancer-related genes
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Reactome (6)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-9931295 pd l1 cd274 glycosylation and translocation to plasma membrane
- R-hsa-9909648 regulation of pd l1 cd274 expression
- R-hsa-9909615 regulation of pd l1 cd274 post translational modification
- R-hsa-388841 regulation of t cell activation by cd28 family
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence53
Ligand-Receptor Signaling (51)
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ligand | ligand | connectomeDB2020 | Yes | Yes | Yes | ||
| ligand | ligand | iTALK | Yes | Yes | Yes | ||
| ligand | ligand | CellPhoneDB | Yes | Yes | Yes | ||
| ligand | ligand | ICELLNET | Yes | Yes | Yes | ||
| ligand | ligand | CellTalkDB | Yes | Yes | Yes | ||
| ligand | ligand | LRdb | Yes | Yes | Yes | ||
| checkpoint | ligand | ICELLNET | Yes | Yes | Yes | ||
| checkpoint_b7 | ligand | ICELLNET | Yes | Yes | Yes | ||
| ligand | ligand | OmniPath | Yes | Yes | Yes | ||
| receptor | receptor | CellCellInteractions | Yes | Yes | Yes |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
273
Mass
30,957
Sequence
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQMEPRTHPTWLLHIFIPFCIIAFIFIATVIALRKQLCQKLYSSKDTTKRPVTTTKREVNSAI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=PD-L2I, Type I; IsoId=Q9BQ51-1; Sequence=Displayed; Name=2; Synonyms=PD-L2II, Type II; IsoId=Q9BQ51-2; Sequence=VSP_013740; Name=3; Synonyms=PD-L2III, Type III; IsoId=Q9BQ51-3; Sequence=VSP_013738, VSP_013739
Alternative Sequence
121..211; ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQS -> G (in isoform 2); 121..182; ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRL -> DGTQDPSNLAASHFHPLLHHCFHFHSHSDSPKKTTLSKAVFFKRHNKKTCHHNKEGSEQCYL (in isoform 3); 183..273; Missing (in isoform 3)
3D Structural Models
Helix
77..82; 94..96; 220..250
Beta Strand
22..24; 29..33; 38..45; 53..62; 84..91; 98..106; 109..120
3D Structure
NMR spectroscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
21..118; Ig-like V-type; 122..203; Ig-like C2-type
Protein Families (2)
- Immunoglobulin superfamily
- BTN/MOG family
Sequence Similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Clinical Relevance
Supporting Publications3
| PMID | Title | Related sentences |
|---|---|---|
| 35366112 | Programmed death receptor ligand-2 (PD-L2) bearing extracellular vesicles as a new biomarker to identify early triple-negative breast cancer patients at high risk for relapse. | Based on the tumor-promoting features of extracellular vesicles (EV) and PD-L1/2-bearing EV subpopulations (PD-L1/2 After enrichment of EV from plasma samples of 56 patients before and 50 after chemotherapy (CT), we determined levels of EV particle number and PD-L1/2 Compared to healthy controls, patients had a tenfold higher EV concentration and significantly elevated PD L2 This study highlights PD L2 \xc2\xa9 2022. Programmed death receptor ligand-2 (PD-L2) bearing extracellular vesicles as a new biomarker to identify early triple-negative breast cancer patients at high risk for relapse. |
| 37547182 | Retroviral b-Zip protein (HBZ) contributes to the release of soluble and exosomal immune checkpoint molecules in the context of neuroinflammation. | For the very first time, we demonstrate a unique elevated presence of several stimulatory (CD27, CD28, 4-1BB) and inhibitory (BTLA, CTLA-4, LAG-3, PD-1, PD-L2) ICP receptors in HAM/TSP sera, and in purified exosomes from a HAM/TSP-derived HTLV-1-producing (OSP2) cells. |
| 39304856 | Type 2-like polarization and elevated CXCL4 secretion of monocyte derived macrophages upon internalization of plasma-derived exosomes from head and neck cancer patients. | Furthermore, we observed a significant type 2-like polarization and elevated CXCL4 secretion of monocyte derived macrophages upon internalization of plasma-derived exosomes from HNSCC patients, which could be visualized by fluorescence microcopy of membrane stained exosomes. Our data revealed elevated overall plasma levels of CTLA-4, PD-L1, and TIM-3 as well as elevated exosome-associated CTLA-4, PD-L2, TIM-3, and LAG-3 levels in HNSCC patients compared to HD. Type 2-like polarization and elevated CXCL4 secretion of monocyte derived macrophages upon internalization of plasma-derived exosomes from head and neck cancer patients. |