Protein detail

CYBC1

Cytochrome b-245 chaperone 1 (Essential for reactive oxygen species protein) (Eros)

Entry name CYBC1	UniProt ID Q9BQA9	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Cytochrome b-245 chaperone 1 (Essential for reactive oxygen species protein) (Eros)

Protein Class (4)

Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins

Protein Function (3)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins

Transmembrane

20..42; Helical

Transmembrane Count

Ensembl

ENSG00000178927

Entrez Gene Symbol

CYBC1

Gene Synonym (4)

C17orf62ErosFLJ90469MGC4368

Gene Description

Cytochrome b-245 chaperone 1

Chromosome

Position

82440912-82450829

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Cell SpecificChoroid plexus epithelial cells

Function & Pathway5

Protein Function (3)

Human disease related genes:Immune system diseases:Primary immunodeficiency
Disease related genes
Predicted intracellular proteins

Cellular Component (2)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence13

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane	TopDB	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	3	22329422 23161513 28396511

Sequence, Structure & Domains8

Sequences

Length

187

Mass

20,774

Sequence

MYLQVETRTSSRLHLKRAPGIRSWSLLVGILSIGLAAAYYSGDSLGWKLFYVTGCLFVAVQNLEDWEEAIFDKSTGKVVLKTFSLYKKLLTLFRAGHDQVVVLLHDVRDVSVEEEKVRYFGKGYMVVLRLATGFSHPLTQSAVMGHRSDVEAIAKLITSFLELHCLESPTELSQSSDSEAGDPASQS

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9BQA9-1; Sequence=Displayed; Name=2; IsoId=Q9BQA9-2; Sequence=VSP_046335

Alternative Sequence

29..42; Missing (in isoform 2)

3D Structural Models

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Protein Families

CYBC1 family

Sequence Similarities

Belongs to the CYBC1 family.

Clinical Relevance2

Disease Involvement (2)

Chronic granulomatous diseaseDisease variant

Antibody

HPA045696

Supporting Publications2

PMID	Title	Abstract
27487081	Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available