Protein detail
FSP1
Ferroptosis suppressor protein 1 (FSP1) (EC 1.6.5.-) (Apoptosis-inducing factor homologous mitochondrion-associated inducer of death) (AMID) (p53-responsive gene 3 protein)
Entry name FSP1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 3 | Transmembrane count 1 | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Ferroptosis suppressor protein 1 (FSP1) (EC 1.6.5.-) (Apoptosis-inducing factor homologous mitochondrion-associated inducer of death) (AMID) (p53-responsive gene 3 protein)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Transmembrane
7..27; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
AMIDFLJ14497FSP1PRG3
Gene Description
Apoptosis inducing factor mitochondria associated 2
Chromosome
10
Position
70098223-70132934
Supporting publications (n)
3
EVMP confidence score
0.38
Fluorescence & Localization3
Tissue SpecificbrainCell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificupper rhombic lip
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (8)
Molecular Function (5)
Biological Process (3)
Reactome (4)
Mediation Categories
Other mediation
Relations & Evidence13
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
Page 1 of 2Next
Sequence, Structure & Domains8
Sequences
Length
373
Mass
40,527
Sequence
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9BRQ8-1; Sequence=Displayed; Name=2; IsoId=Q9BRQ8-2; Sequence=VSP_052047, VSP_052048
Alternative Sequence
99..138; Missing (in isoform 2); 206; S -> SLLG (in isoform 2)
3D Structural Models
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Protein Families
FAD-dependent oxidoreductase family
Sequence Similarities
Belongs to the FAD-dependent oxidoreductase family.
Clinical Relevance5
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 33919183 | Multiple-Cycle Polymeric Extracellular Vesicle Precipitation and Its Evaluation by Targeted Mass Spectrometry. | No abstract available |
| 36797805 | Magnetic transferrin nanoparticles (MTNs) assay as a novel isolation approach for exosomal biomarkers in neurological diseases. | No abstract available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No abstract available |