Protein detail

ZNF2

Zinc finger protein 2 (Zinc finger protein 2.2) (Zinc finger protein 661)

Protein symbol ZNF2	UniProt ID Q9BSG1	EVMP score 0.38
Frequency 1	Transmembrane count	Protein classification Predicted intracellular proteinsTranscription factors

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Zinc finger protein 2 (Zinc finger protein 2.2) (Zinc finger protein 661)

Protein Class

Predicted intracellular proteinsTranscription factors

Protein Function

Predicted intracellular proteins
Transcription factors:Zinc-coordinating DNA-binding domains

Ensembl

ENSG00000275111

Entrez Gene Symbol

ZNF2

Gene Synonym

A1-5Zfp661ZNF661

Gene Description

Zinc finger protein 2

Chromosome

Position

95165432-95184317

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specifichippocampal dentate gyrusBlood Cell SpecificneutrophilBlood Lineage SpecificB-cells

Function & Pathway

Protein Function

Predicted intracellular proteins
Transcription factors:Zinc-coordinating DNA-binding domains

Cellular Component

GO:0005634 nucleus

Molecular Function

Biological Process

Reactome

R-hsa-73857 rna polymerase ii transcription

Mediation Categories

Other mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

95 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
anti-BHC110 complex	GSE1 GTF2I HDAC1 HDAC2 HMG20B KDM1A PHF21A RCOR1 ZMYM2 ZMYM3 ZNF217	O60341 O75362 P78347 Q13547 Q14202 Q14687 Q92769 Q96BD5 Q9P0W2 Q9UBW7 Q9UKL0	1:1:1:1:1:1:1:1:1:1:1	CompleatCORUM	CORUM:633Compleat:HC2467	12493763
histone deacetylase complex	CBX5 CIR1 HDAC1 HDAC10 HDAC11 HDAC3 HDAC4 HDAC5 HDAC6 HDAC7 HDAC8 HDAC9 HR MBD2 MECOM MTA2 NCOR1 NRIP1 PHF21A RERE SAP18 SAP30 SATB2 TAF6L TAL1 TBL1X TBL1XR1 ZNF217	O00422 O15379 O43593 O60907 O75362 O75376 O75446 O94776 P17542 P45973 P48552 P56524 Q03112 Q13547 Q86X95 Q8WUI4 Q969S8 Q96BD5 Q96DB2 Q9BY41 Q9BZK7 Q9P2R6 Q9UBB5 Q9UBN7 Q9UKV0 Q9UPW6 Q9UQL6 Q9Y6J9	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC1117	11804585 9150135 9651585 18326024 9874765 18625718 11948178 19497860 11568182 10444591 12711221 9674425 15325272 11861901
	ATOSA CDCA4 FBXL16 FOXC1 FOXC2 PABIR1 PABIR2 PPP2R2A PPP2R2D PTPDC1 SERTAD4 UNG XPOT ZFP1 ZNF235	A2A3K4 O43592 P13051 P63151 Q12948 Q14590 Q32MH5 Q66LE6 Q6P2D0 Q7Z309 Q8N461 Q96E09 Q99958 Q9BXL8 Q9NUC0	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
	MEIOC YTHDC2 ZNF223 ZNF550 ZNF714	A2RUB1 Q7Z398 Q96N38 Q9H6S0 Q9UK11	0:0:0:0:0	hu.MAP2
	ATOX1 CRIP1 DNPEP ZNF286A	O00244 P50238 Q9HBT8 Q9ULA0	0:0:0:0	hu.MAP2
	AKR1D1 ATOX1 DNPEP PGM2L1 ZNF286A	O00244 P51857 Q6PCE3 Q9HBT8 Q9ULA0	0:0:0:0:0	hu.MAP2
	EMILIN2 MATN2 NELL1 NELL2 ZNF260	O00339 Q3ZCT1 Q92832 Q99435 Q9BXX0	0:0:0:0:0	hu.MAP2
	CDK2AP1 CHD3 CHD5 GATAD2A GATAD2B MBD2 MBD3 MTA3 ZBTB7B ZNF219	O14519 O15156 O95983 Q12873 Q86YP4 Q8TDI0 Q8WXI9 Q9BTC8 Q9P2Y4 Q9UBB5	0:0:0:0:0:0:0:0:0:0	hu.MAP
	ASF1B CDK2AP1 CHD3 CHD4 CHD5 GATAD2A GATAD2B HDAC2 MBD2 MBD3 MTA2 MTA3 RBBP4 ZBTB2 ZNF219	O14519 O94776 O95983 Q09028 Q12873 Q14839 Q86YP4 Q8N680 Q8TDI0 Q8WXI9 Q92769 Q9BTC8 Q9NVP2 Q9P2Y4 Q9UBB5	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
	CHD1 H2BC5 OARD1 PHIP TMPO ZNF207	O14646 O43670 P42166 P58876 Q8WWQ0 Q9Y530	0:0:0:0:0:0	hu.MAP2

Page 2 of 10Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation；Size Exclusion Chromatography	Flow cytometryMORPH	1	41216884

Sequence, Structure & Domains

Sequences

Length

425

Mass

48,707

Sequence

MAAVSPTTRCQESVTFEDVAVVFTDEEWSRLVPIQRDLYKEVMLENYNSIVSLGLPVPQPDVIFQLKRGDKPWMVDLHGSEEREWPESVSLDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQECSDCGKTFFDHSSLTRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGESPYECSVCSKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIHTGESPYECHQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECGKAFFDRSSLTQHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECTVCGKVFSSKSSVIQHQRRYAKQGID

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=2; IsoId=Q9BSG1-2; Sequence=Displayed; Name=3; IsoId=Q9BSG1-3; Sequence=VSP_060238; Name=4; IsoId=Q9BSG1-4; Sequence=VSP_060237

Alternative Sequence

1..42; Missing (in isoform 3); 54..91; Missing (in isoform 4)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

93..110; Basic and acidic residues; 144..154; Basic and acidic residues

Zinc Finger

173..195; C2H2-type 1; 201..223; C2H2-type 2; 229..251; C2H2-type 3; 257..279; C2H2-type 4; 285..307; C2H2-type 5; 313..335; C2H2-type 6; 341..363; C2H2-type 7; 369..391; C2H2-type 8; 397..419; C2H2-type 9; degenerate

Domain (FT)

14..85; KRAB

Region

86..110; Disordered; 122..163; Disordered

Protein Families

Krueppel C2H2-type zinc-finger protein family

Sequence Similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Clinical Relevance

Antibody

HPA041358

Interaction Protein

ENSG00000130726

Interaction Count

Interaction Dataset

biogrid_bioplex