Protein detail

ZNF2

Zinc finger protein 2 (Zinc finger protein 2.2) (Zinc finger protein 661)

Protein symbol ZNF2	UniProt ID Q9BSG1	EVMP score 0.38
Frequency 1	Transmembrane count	Protein classification Predicted intracellular proteinsTranscription factors

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Zinc finger protein 2 (Zinc finger protein 2.2) (Zinc finger protein 661)

Protein Class

Predicted intracellular proteinsTranscription factors

Protein Function

Predicted intracellular proteins
Transcription factors:Zinc-coordinating DNA-binding domains

Ensembl

ENSG00000275111

Entrez Gene Symbol

ZNF2

Gene Synonym

A1-5Zfp661ZNF661

Gene Description

Zinc finger protein 2

Chromosome

Position

95165432-95184317

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specifichippocampal dentate gyrusBlood Cell SpecificneutrophilBlood Lineage SpecificB-cells

Function & Pathway

Protein Function

Predicted intracellular proteins
Transcription factors:Zinc-coordinating DNA-binding domains

Cellular Component

GO:0005634 nucleus

Molecular Function

Biological Process

Reactome

R-hsa-73857 rna polymerase ii transcription

Mediation Categories

Other mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

95 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CCND1 CCND2 CCND3 CCNE1 CCNE2 CDK2 CDK3 CDKN1A CDKN1B CDKN1C CDKN2C CDKN3 MAPK15 ZNF2	O96020 P24385 P24864 P24941 P30279 P30281 P38936 P42773 P46527 P49918 Q00526 Q16667 Q8TD08 Q9BSG1	0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
CCND1 CCND2 CCND3 CCNE2 CDK2 CDKN1A CDKN1B CDKN1C CDKN2C CDKN3 MAPK15 RBL1 RBL2 ZNF2	O96020 P24385 P24941 P28749 P30279 P30281 P38936 P42773 P46527 P49918 Q08999 Q16667 Q8TD08 Q9BSG1	0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
APOA1 MAPK6 MAPKAPK5 SERPINA1 ZNF28 ZNF468 ZNF7	P01009 P02647 P17035 P17097 Q16659 Q5VIY5 Q8IW41	0:0:0:0:0:0:0	hu.MAP2
APOA1 FBXL5 MAPK6 MAPKAPK5 SERPINA1 ZNF28 ZNF468 ZNF7	P01009 P02647 P17035 P17097 Q16659 Q5VIY5 Q8IW41 Q9UKA1	0:0:0:0:0:0:0:0	hu.MAP2
TRIM27 ZNF219	P14373 Q9P2Y4	0:0	hu.MAP
ZNF22 ZNF808	P17026 Q8N4W9	0:0	hu.MAP2
NMNAT1 ZNF22 ZNF808	P17026 Q8N4W9 Q9HAN9	0:0:0	hu.MAP
ZNF24	P17028	2	PDB	PDB:3lhr
OR8B2 YY1 ZNF24 ZNF638 ZNF830	P17028 P25490 Q14966 Q96NB3 Q96RD0	0:0:0:0:0	Havugimana2012	Havugimana2012:C_430
SCAND1 ZNF24	P17028 P57086	0:0	hu.MAP2

Page 6 of 10Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation；Size Exclusion Chromatography	Flow cytometryMORPH	1	41216884

Sequence, Structure & Domains

Sequences

Length

425

Mass

48,707

Sequence

MAAVSPTTRCQESVTFEDVAVVFTDEEWSRLVPIQRDLYKEVMLENYNSIVSLGLPVPQPDVIFQLKRGDKPWMVDLHGSEEREWPESVSLDWETKPEIHDASDKKSEGSLRECLGRQSPLCPKFEVHTPNGRMGTEKQSPSGETRKKSLSRDKGLRRRSALSREILTKERHQECSDCGKTFFDHSSLTRHQRTHTGEKPYDCRECGKAFSHRSSLSRHLMSHTGESPYECSVCSKAFFDRSSLTVHQRIHTGEKPFQCNECGKAFFDRSSLTRHQRIHTGESPYECHQCGKAFSQKSILTRHQLIHTGRKPYECNECGKAFYGVSSLNRHQKAHAGDPRYQCNECGKAFFDRSSLTQHQKIHTGDKPYECSECGKAFSQRCRLTRHQRVHTGEKPFECTVCGKVFSSKSSVIQHQRRYAKQGID

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=2; IsoId=Q9BSG1-2; Sequence=Displayed; Name=3; IsoId=Q9BSG1-3; Sequence=VSP_060238; Name=4; IsoId=Q9BSG1-4; Sequence=VSP_060237

Alternative Sequence

1..42; Missing (in isoform 3); 54..91; Missing (in isoform 4)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

93..110; Basic and acidic residues; 144..154; Basic and acidic residues

Zinc Finger

173..195; C2H2-type 1; 201..223; C2H2-type 2; 229..251; C2H2-type 3; 257..279; C2H2-type 4; 285..307; C2H2-type 5; 313..335; C2H2-type 6; 341..363; C2H2-type 7; 369..391; C2H2-type 8; 397..419; C2H2-type 9; degenerate

Domain (FT)

14..85; KRAB

Region

86..110; Disordered; 122..163; Disordered

Protein Families

Krueppel C2H2-type zinc-finger protein family

Sequence Similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Clinical Relevance

Antibody

HPA041358

Interaction Protein

ENSG00000130726

Interaction Count

Interaction Dataset

biogrid_bioplex