Protein detail

P4K2A

Phosphatidylinositol 4-kinase type 2-alpha (EC 2.7.1.67) (Phosphatidylinositol 4-kinase type II-alpha)

Entry name P4K2A	UniProt ID Q9BTU6	EVMP confidence score 0.88
Supporting publications (n) 34	Transmembrane count	Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Phosphatidylinositol 4-kinase type 2-alpha (EC 2.7.1.67) (Phosphatidylinositol 4-kinase type II-alpha)

Protein Class (3)

EnzymesMetabolic proteinsPredicted intracellular proteins

Protein Function (3)

ENZYME proteins:Transferases
Enzymes
Predicted intracellular proteins

Ensembl

ENSG00000155252

Entrez Gene Symbol

PI4K2A

Gene Synonym (3)

DKFZP761G1923PI4KIIPIK42A

Gene Description

Phosphatidylinositol 4-kinase type 2 alpha

Chromosome

Position

97640671-97676434

Supporting publications (n)

EVMP confidence score

0.88

Fluorescence & Localization3

Cell SpecificNeutrophil progenitorsBlood Cell SpecificneutrophilBlood Lineage Specificdendritic cells

Function & Pathway7

Protein Function (3)

ENZYME proteins:Transferases
Enzymes
Predicted intracellular proteins

Cellular Component (21)

Page 1 of 3

Molecular Function (5)

Biological Process (3)

KEGG (3)

Reactome (6)

Mediation Categories (2)

Fusion and delivery mediationMetabolism mediation

Relations & Evidence15

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
receptor	receptor	scConnect	No	Yes	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
P4K2A	Q9BTU6	CLSPN	Q9HAW4	Yes	No	Yes	SIGNOR_ProtMapperiPTMnetSIGNORProtMapper	SIGNOR:18082599 ProtMapper:18082599

Protein Complex Composition (4)

4 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
CLTC-PI4K2A complex	CLTC PI4K2A	Q00610 Q9BTU6	0:0	CORUM	CORUM:6691	23676666
PI4K2A-PLDN complex	BLOC1S6 PI4K2A	Q9BTU6 Q9UL45	0:0	CORUM	CORUM:6692	23676666
PIP5K1B-PI4K2A complex	PI4K2A PIP5K1B	O14986 Q9BTU6	0:0	CORUM	CORUM:6707	19561074
	PI4K2A	Q9BTU6	2	PDB	PDB:4hnePDB:4hnd

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity CaptureMicrofluidics-Based Methods	Mass spectrometryWestern blottingFlow cytometryMORPHELISA	22	34754007 39290459 31508500 39873726 40545963 32795414 38731868 26801919 30071318 33709510 40619995 27312428 32468033 36635400 37686366 40098346 30760538 35551477 31320591 41216884 40091455 38136601

Sequence, Structure & Domains12

Sequences

Length

479

Mass

54,022

Sequence

MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW

3D Structural Models

Turn

164..166; 359..361

Helix

78..93; 95..99; 108..122; 154..156; 167..171; 189..203; 225..231; 270..279; 284..304; 365..368; 370..373; 378..388; 391..405; 413..435; 440..444

Beta Strand

131..136; 138..141; 147..153; 211..216; 235..237; 249..251; 256..262; 266..269; 313..318; 339..344

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Compositional Bias

31..45; Low complexity; 53..66; Basic and acidic residues

Domain (FT)

124..453; PI3K/PI4K catalytic

Region

1..74; Disordered; 130..136; G-loop; 157..159; Important for substrate binding; 165..178; Important for interaction with membranes; 268..276; Important for interaction with membranes; 305..313; Catalytic loop; 344..364; Activation loop; 359..368; Important for interaction with membranes

Protein Families (2)

PI3/PI4-kinase family
Type II PI4K subfamily

Sequence Similarities

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

Clinical Relevance2

Disease Involvement (3)

Disease variantEpilepsyIntellectual disability

Antibody (2)

CAB030649 HPA076857

Supporting Publications34

PMID	Title	Abstract
25950383	Proteome characterization of melanoma exosomes reveals a specific signature for metastatic cell lines.	No abstract available
26801919	Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis.	No abstract available
26884841	Exosomes mediated pentose phosphate pathway in ovarian cancer metastasis: a proteomics analysis.	No abstract available
27312428	A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer.	No abstract available
27723984	Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection.	No abstract available
28242843	Label-free Proteomic Analysis of Exosomes Derived from Inducible Hepatitis B Virus-Replicating HepAD38 Cell Line.	No abstract available
28396511	Database-augmented Mass Spectrometry Analysis of Exosomes Identifies Claudin 3 as a Putative Prostate Cancer Biomarker.	No abstract available
30353492	Extracellular Vesicles Released by Glioblastoma Cells Stimulate Normal Astrocytes to Acquire a Tumor-Supportive Phenotype Via p53 and MYC Signaling Pathways.	No abstract available
30451371	Extracellular Vesicles from Neurosurgical Aspirates Identifies Chaperonin Containing TCP1 Subunit 6A as a Potential Glioblastoma Biomarker with Prognostic Significance.	No abstract available
30550287	Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes.	No abstract available

Page 1 of 4Next