Protein detail
P4K2A
Phosphatidylinositol 4-kinase type 2-alpha (EC 2.7.1.67) (Phosphatidylinositol 4-kinase type II-alpha)
Entry name P4K2A | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 34 | Transmembrane count | Protein classification EnzymesMetabolic proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Phosphatidylinositol 4-kinase type 2-alpha (EC 2.7.1.67) (Phosphatidylinositol 4-kinase type II-alpha)
Protein Class (3)
EnzymesMetabolic proteinsPredicted intracellular proteins
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
DKFZP761G1923PI4KIIPIK42A
Gene Description
Phosphatidylinositol 4-kinase type 2 alpha
Chromosome
10
Position
97640671-97676434
Supporting publications (n)
34
EVMP confidence score
0.75
Fluorescence & Localization
Cell SpecificNeutrophil progenitorsBlood Cell SpecificneutrophilBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function (3)
- ENZYME proteins:Transferases
- Enzymes
- Predicted intracellular proteins
Cellular Component (21)
- GO:0000139 Golgi membrane
- GO:0005739 mitochondrion
- GO:0005765 lysosomal membrane
- GO:0005768 endosome
- GO:0005802 trans-Golgi network
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0010008 endosome membrane
- GO:0016020 membrane
- GO:0030425 dendrite
Page 1 of 3
Molecular Function (5)
Biological Process (3)
KEGG (3)
Reactome (6)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence15
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| P4K2A | Q9BTU6 | CLSPN | Q9HAW4 | Yes | Yes | SIGNOR_ProtMapperiPTMnetSIGNORProtMapper | SIGNOR:18082599ProtMapper:18082599 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CLTC-PI4K2A complex | CLTCPI4K2A | Q00610Q9BTU6 | 0:0 | CORUM | CORUM:6691 | 23676666 |
| PI4K2A-PLDN complex | BLOC1S6PI4K2A | Q9BTU6Q9UL45 | 0:0 | CORUM | CORUM:6692 | 23676666 |
| PIP5K1B-PI4K2A complex | PI4K2APIP5K1B | O14986Q9BTU6 | 0:0 | CORUM | CORUM:6707 | 19561074 |
| PI4K2A | Q9BTU6 | 2 | PDB | PDB:4hnePDB:4hnd |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity CaptureMicrofluidics-Based Methods | Mass spectrometryWestern blottingFlow cytometryMORPHELISA | 22 | 34754007392904593150850039873726405459633279541438731868268019193007131833709510406199952731242832468033366354003768636640098346307605383555147731320591412168844009145538136601 |
Sequence, Structure & Domains
Sequences
Length
479
Mass
54,022
Sequence
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
3D Structural Models
Turn
164..166; 359..361
Helix
78..93; 95..99; 108..122; 154..156; 167..171; 189..203; 225..231; 270..279; 284..304; 365..368; 370..373; 378..388; 391..405; 413..435; 440..444
Beta Strand
131..136; 138..141; 147..153; 211..216; 235..237; 249..251; 256..262; 266..269; 313..318; 339..344
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Compositional Bias
31..45; Low complexity; 53..66; Basic and acidic residues
Domain (FT)
124..453; PI3K/PI4K catalytic
Region
1..74; Disordered; 130..136; G-loop; 157..159; Important for substrate binding; 165..178; Important for interaction with membranes; 268..276; Important for interaction with membranes; 305..313; Catalytic loop; 344..364; Activation loop; 359..368; Important for interaction with membranes
Protein Families (2)
- PI3/PI4-kinase family
- Type II PI4K subfamily
Sequence Similarities
Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.
Clinical Relevance
Disease Involvement (3)
Disease variantEpilepsyIntellectual disability
Related Diseases (2)
Supporting Publications34
| PMID | Title | Related sentences |
|---|---|---|
| 30608700 | Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs. | No related sentences available |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No related sentences available |
| 30975894 | Use of extracellular vesicles from lymphatic drainage as surrogate markers of melanoma progression and BRAF V600E mutation. | No related sentences available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No related sentences available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No related sentences available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 33718342 | Extracellular Vesicles Derived From Adult and Fetal Bone Marrow Mesenchymal Stromal Cells Differentially Promote ex vivo Expansion of Hematopoietic Stem and Progenitor Cells. | No related sentences available |
| 34202855 | Proteomic Profiling of Ectosomes Derived from Paired Urothelial Bladder Cancer and Normal Cells Reveals the Presence of Biologically-Relevant Molecules. | No related sentences available |
| 34681663 | Proteomic Landscape of Extracellular Vesicles for Diffuse Large B-Cell Lymphoma Subtyping. | No related sentences available |