Protein detail
SRBS1
Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP)
Entry name SRBS1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
CAPFLJ12406KIAA1296ponsinSH3D5sh3p12
Gene Description
Sorbin and SH3 domain containing 1
Chromosome
10
Position
95311771-95561414
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization4
Tissue Specificbone marrowCell SpecificAstrocytesBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway8
Protein Function
Predicted intracellular proteins
Cellular Component (13)
- GO:0001725 stress fiber
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005813 centrosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005912 adherens junction
- GO:0005915 zonula adherens
- GO:0005925 focal adhesion
- GO:0016363 nuclear matrix
Page 1 of 2
Molecular Function (5)
Biological Process (3)
KEGG (4)
Canonical Pathways
M236 Pid delta np63 pathway
Mediation Categories (2)
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence26
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SORBS1 | SRC | P12931 | Y | 536 | phosphorylation | RLIMS-P_ProtMapperProtMapper | ProtMapper:19891780 |
| SORBS1 | ABL1 | P00519 | Y | 536 | phosphorylation | RLIMS-P_ProtMapperProtMapper | ProtMapper:19891780 |
| SORBS1 | CDK1 | P06493 | S | 345 | phosphorylation | KEA | KEA:17570479 |
| SORBS1 | GSK3B | P49841 | S | 345 | phosphorylation | KEA | KEA:17570479 |
| SORBS1 | RPS6KA3 | P51812 | S | 270 | phosphorylation | KEA | KEA:17570479 |
| SORBS1 | RPS6KA3 | P51812 | S | 345 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| adherens_junction | adherens_junction | Ramilowski_location | No | Yes | Yes | No | No |
| adherens_junction | adherens_junction | OmniPath | No | Yes | Yes | No | No |
| adhesion_cytoskeleton_adaptor | intracellular_intercellular_related | Adhesome | Yes | No | Yes | No | No |
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes | No | Yes | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | No |
Page 1 of 2Next
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ABL1 | P00519 | SRBS1 | Q9BX66 | Yes | Yes | No | WangAdhesomeiPTMnetPhosphoPointSIGNORHPRDHINTBioGRIDSPIKE_LCSPIKE | Adhesome:19891780HINT:19891780SIGNOR:19891780HPRD:11374898SPIKE:19891780HINT:11374898SPIKE_LC:17145710Adhesome:18768933SPIKE_LC:20841568SPIKE_LC:19891780SPIKE:20841568Adhesome:11374898BioGRID:11374898 |
| SRBS1 | Q9BX66 | CBL | P22681 | Yes | Yes | No | HPRDWangSIGNORAdhesome | Adhesome:12765336Adhesome:9447983HPRD:11001060Adhesome:12504111SIGNOR:11001060Adhesome:15128873Adhesome:17548467 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ACTA1ACTBACTL6ADMAP1EPC2KAT5MEAF6MORF4L1MORF4L2MRGBPNRAPSORBS1TRRAPVPS72YEATS4 | O95619O96019P60709P68133Q15014Q15906Q52LR7Q86VF7Q92993Q9BX66Q9HAF1Q9NPF5Q9NV56Q9UBU8Q9Y4A5 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4048 | ||
| ACTA1ACTL6ADMAP1EPC1EPC2ING3KAT5MEAF6MORF4L1MORF4L2MRGBPSORBS1TRRAPVPS72YEATS4 | O95619O96019P68133Q15014Q15906Q52LR7Q92993Q9BX66Q9H2F5Q9HAF1Q9NPF5Q9NV56Q9NXR8Q9UBU8Q9Y4A5 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5844 | ||
| SORBS1VCL | P18206Q9BX66 | 1:1 | PDB | PDB:4ln2PDB:4lnp | ||
| PXNSORBS1 | P49023Q9BX66 | 1:1 | PDB | PDB:2o9v |
Sequence, Structure & Domains12
Sequences
Length
1,292
Mass
142,513
Sequence
MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMDLTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYKFPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHSKLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGEQAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL
Alternative Products
Event=Alternative splicing; Named isoforms=12; Name=1; IsoId=Q9BX66-1; Sequence=Displayed; Name=2; IsoId=Q9BX66-2; Sequence=VSP_050902, VSP_050910; Name=3; IsoId=Q9BX66-3; Sequence=VSP_050898, VSP_050900, VSP_050906, VSP_050912, VSP_050913; Name=4; IsoId=Q9BX66-4; Sequence=VSP_050895, VSP_050896, VSP_050899, VSP_050900, VSP_050903, VSP_050907, VSP_050911; Name=5; IsoId=Q9BX66-5; Sequence=VSP_050896, VSP_050901, VSP_050911; Name=6; IsoId=Q9BX66-6; Sequence=VSP_050896, VSP_050899, VSP_050905, VSP_050911; Name=7; IsoId=Q9BX66-7; Sequence=VSP_050895, VSP_050896, VSP_050900, VSP_050903, VSP_050908, VSP_050909; Name=8; IsoId=Q9BX66-8; Sequence=VSP_050895, VSP_050899, VSP_050900, VSP_050904, VSP_050911; Name=9; IsoId=Q9BX66-9; Sequence=VSP_050899, VSP_050900, VSP_050903, VSP_050911; Name=10; IsoId=Q9BX66-10; Sequence=VSP_050895, VSP_050900, VSP_050903, VSP_050907, VSP_050911; Name=11; IsoId=Q9BX66-11; Sequence=VSP_050900, VSP_039210; Name=12; IsoId=Q9BX66-12; Sequence=VSP_050895, VSP_050899, VSP_041193, VSP_050900, VSP_050904, VSP_041194, VSP_050911
Alternative Sequence
26..57; Missing (in isoform 4, isoform 7, isoform 8, isoform 10 and isoform 12); 101..109; Missing (in isoform 4, isoform 5, isoform 6 and isoform 7); 147..215; Missing (in isoform 3); 148..270; Missing (in isoform 4, isoform 6, isoform 8, isoform 9 and isoform 12); 319..328; Missing (in isoform 12); 408..453; Missing (in isoform 3, isoform 4, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11 and isoform 12); 431..451; Missing (in isoform 5); 434..453; DNPYTPTYQFPASTPSPKSE -> TKSCSVMSPRLECSGTVIAHCSLKLLDSSNPPTSASQVAGTA (in isoform 2); 552..635; Missing (in isoform 4, isoform 7, isoform 9 and isoform 10); 580..635; Missing (in isoform 6); 580..601; Missing (in isoform 8 and isoform 12); 602..635; Missing (in isoform 3); 709; K -> KVDRKGGNAHMISSSSVHSRTFNTSNALGPVCKHKKPLSAAKACISEILPSKFKPRLSAPSALLQEQKSILLPSEKAQSCENLCVSGSLNDSKRGLPLQVGGSIENLLMRSRRDYDSKSSSTMSLQEYSTSGRRPCPLSRKAGMQFTMLYRDMHQINRSGLFLGSISSSSSVRDLASHFEKSSLALSRGELGPSQEGSEHIPKHTVSSRITAFEQLIQRSRSMPSLDLSGRLSKSPTPVLSRGSLTSARSAESLLESTKLHPKEMDGMNSSGVYASPTCSNMAHHALSFRGLVPSEPLSTCSDDVDRCSNISTDSREGSGGSVHGDFPKHRLNKCKGTCPASYTRFTTIRKHEQQQTSRQPEWRLDARGDKSTLLRNIYLMSPLPFRLKKPLHHHPRQPSPGDSSGLLVGQKPDLPSQPHQDQPPSGGKPVVPTRLSSRHTMARLSRSSEPSQERPTALEDYPRAINNGNSVPYSDHSLDRNNNPQSELAPSRG (in isoform 12); 738..793; Missing (in isoform 4 and isoform 10); 795..799; MRPAR -> KYDWA (in isoform 7); 800..1292; Missing (in isoform 7); 955..1212; Missing (in isoform 4, isoform 5, isoform 6, isoform 8, isoform 9, isoform 10 and isoform 12); 955..1117; Missing (in isoform 2); 956..975; FSSHSKLITPAPSSLPHSRR -> LSHHSLRAGPDLTESEKSYV (in isoform 3); 976..1213; Missing (in isoform 3); 1213; Q -> QLSHHSLRAGPDLTESEKSYV (in isoform 11)
3D Structural Models
Turn
910..912; 1274..1276
Helix
844..846; 920..922
Beta Strand
796..802; 808..811; 819..825; 827..835; 838..843; 847..849; 863..865; 870..874; 882..885; 893..899; 901..908; 915..919; 923..927; 1230..1233; 1235..1240; 1257..1263; 1267..1273; 1279..1283; 1286..1289
3D Structure
NMR spectroscopy (5); X-ray crystallography (6)
Domain & Motif Annotations
Compositional Bias
74..89; Low complexity; 93..102; Basic and acidic residues; 114..128; Polar residues; 240..252; Pro residues; 266..275; Polar residues; 354..365; Basic and acidic residues; 437..450; Polar residues; 510..534; Basic and acidic residues; 944..954; Low complexity; 955..971; Polar residues; 1106..1117; Polar residues; 1119..1136; Basic and acidic residues; 1162..1172; Polar residues; 1192..1203; Basic and acidic residues; 1211..1230; Polar residues
Domain (FT)
366..469; SoHo; 793..852; SH3 1; 867..928; SH3 2; 1231..1292; SH3 3
Region
1..29; Disordered; 73..158; Disordered; 214..275; Disordered; 318..381; Disordered; 405..534; Disordered; 628..650; Disordered; 692..716; Disordered; 944..976; Disordered; 1041..1064; Disordered; 1106..1150; Disordered; 1162..1230; Disordered
Clinical Relevance4
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 35399949 | Integration of Metabolomics and Proteomics in Exploring the Endothelial Dysfunction Mechanism Induced by Serum Exosomes From Diabetic Retinopathy and Diabetic Nephropathy Patients. | No abstract available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |