Protein detail

SRBS1

Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP)

Entry name SRBS1	UniProt ID Q9BX66	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Sorbin and SH3 domain-containing protein 1 (Ponsin) (SH3 domain protein 5) (SH3P12) (c-Cbl-associated protein) (CAP)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000095637

Entrez Gene Symbol

SORBS1

Gene Synonym (6)

CAPFLJ12406KIAA1296ponsinSH3D5sh3p12

Gene Description

Sorbin and SH3 domain containing 1

Chromosome

Position

95311771-95561414

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization4

Tissue Specificbone marrowCell SpecificAstrocytesBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway8

Protein Function

Predicted intracellular proteins

Cellular Component (13)

Page 1 of 2

Molecular Function (5)

Biological Process (3)

KEGG (4)

Reactome (2)

Canonical Pathways

M236 Pid delta np63 pathway

Mediation Categories (2)

Adhesion and uptake mediationFusion and delivery mediation

Relations & Evidence26

Enzyme-Mediated Modification (6)

6 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SORBS1	SRC	P12931	Y	536	phosphorylation	RLIMS-P_ProtMapperProtMapper	ProtMapper:19891780
SORBS1	ABL1	P00519	Y	536	phosphorylation	RLIMS-P_ProtMapperProtMapper	ProtMapper:19891780
SORBS1	CDK1	P06493	S	345	phosphorylation	KEA	KEA:17570479
SORBS1	GSK3B	P49841	S	345	phosphorylation	KEA	KEA:17570479
SORBS1	RPS6KA3	P51812	S	270	phosphorylation	KEA	KEA:17570479
SORBS1	RPS6KA3	P51812	S	345	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (13)

13 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane	plasma_membrane	OmniPath	No	No	Yes	No	No
secreted	secreted	Cellinker	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No

Page 2 of 2Previous

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ABL1	P00519	SRBS1	Q9BX66	Yes	Yes	No	WangAdhesomeiPTMnetPhosphoPointSIGNORHPRDHINTBioGRIDSPIKE_LCSPIKE	Adhesome:19891780 HINT:19891780 SIGNOR:19891780 HPRD:11374898 SPIKE:19891780 HINT:11374898 SPIKE_LC:17145710 Adhesome:18768933 SPIKE_LC:20841568 SPIKE_LC:19891780 SPIKE:20841568 Adhesome:11374898 BioGRID:11374898
SRBS1	Q9BX66	CBL	P22681	Yes	Yes	No	HPRDWangSIGNORAdhesome	Adhesome:12765336 Adhesome:9447983 HPRD:11001060 Adhesome:12504111 SIGNOR:11001060 Adhesome:15128873 Adhesome:17548467

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ACTA1 ACTB ACTL6A DMAP1 EPC2 KAT5 MEAF6 MORF4L1 MORF4L2 MRGBP NRAP SORBS1 TRRAP VPS72 YEATS4	O95619 O96019 P60709 P68133 Q15014 Q15906 Q52LR7 Q86VF7 Q92993 Q9BX66 Q9HAF1 Q9NPF5 Q9NV56 Q9UBU8 Q9Y4A5	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4048
ACTA1 ACTL6A DMAP1 EPC1 EPC2 ING3 KAT5 MEAF6 MORF4L1 MORF4L2 MRGBP SORBS1 TRRAP VPS72 YEATS4	O95619 O96019 P68133 Q15014 Q15906 Q52LR7 Q92993 Q9BX66 Q9H2F5 Q9HAF1 Q9NPF5 Q9NV56 Q9NXR8 Q9UBU8 Q9Y4A5	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5844
SORBS1 VCL	P18206 Q9BX66	1:1	PDB	PDB:4ln2PDB:4lnp
PXN SORBS1	P49023 Q9BX66	1:1	PDB	PDB:2o9v

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	6	38037300 40689422 38871114 34265469 38576002 39996590

Sequence, Structure & Domains12

Sequences

Length

1,292

Mass

142,513

Sequence

MSSECDGGSKAVMNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVKNASGLVLPTDMDLTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADANGNAQPSSLAAKGYRSVHPNLPSDKSQDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPTPLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSFSPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPSVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAIEKRAKDDSRRVVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYKFPELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSRSATASPQFSSHSKLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLPPLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYERKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGSEAEQTERHRGGEQAGRKAARRGGSQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPLYL

Alternative Products

Event=Alternative splicing; Named isoforms=12; Name=1; IsoId=Q9BX66-1; Sequence=Displayed; Name=2; IsoId=Q9BX66-2; Sequence=VSP_050902, VSP_050910; Name=3; IsoId=Q9BX66-3; Sequence=VSP_050898, VSP_050900, VSP_050906, VSP_050912, VSP_050913; Name=4; IsoId=Q9BX66-4; Sequence=VSP_050895, VSP_050896, VSP_050899, VSP_050900, VSP_050903, VSP_050907, VSP_050911; Name=5; IsoId=Q9BX66-5; Sequence=VSP_050896, VSP_050901, VSP_050911; Name=6; IsoId=Q9BX66-6; Sequence=VSP_050896, VSP_050899, VSP_050905, VSP_050911; Name=7; IsoId=Q9BX66-7; Sequence=VSP_050895, VSP_050896, VSP_050900, VSP_050903, VSP_050908, VSP_050909; Name=8; IsoId=Q9BX66-8; Sequence=VSP_050895, VSP_050899, VSP_050900, VSP_050904, VSP_050911; Name=9; IsoId=Q9BX66-9; Sequence=VSP_050899, VSP_050900, VSP_050903, VSP_050911; Name=10; IsoId=Q9BX66-10; Sequence=VSP_050895, VSP_050900, VSP_050903, VSP_050907, VSP_050911; Name=11; IsoId=Q9BX66-11; Sequence=VSP_050900, VSP_039210; Name=12; IsoId=Q9BX66-12; Sequence=VSP_050895, VSP_050899, VSP_041193, VSP_050900, VSP_050904, VSP_041194, VSP_050911

Alternative Sequence

26..57; Missing (in isoform 4, isoform 7, isoform 8, isoform 10 and isoform 12); 101..109; Missing (in isoform 4, isoform 5, isoform 6 and isoform 7); 147..215; Missing (in isoform 3); 148..270; Missing (in isoform 4, isoform 6, isoform 8, isoform 9 and isoform 12); 319..328; Missing (in isoform 12); 408..453; Missing (in isoform 3, isoform 4, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11 and isoform 12); 431..451; Missing (in isoform 5); 434..453; DNPYTPTYQFPASTPSPKSE -> TKSCSVMSPRLECSGTVIAHCSLKLLDSSNPPTSASQVAGTA (in isoform 2); 552..635; Missing (in isoform 4, isoform 7, isoform 9 and isoform 10); 580..635; Missing (in isoform 6); 580..601; Missing (in isoform 8 and isoform 12); 602..635; Missing (in isoform 3); 709; K -> KVDRKGGNAHMISSSSVHSRTFNTSNALGPVCKHKKPLSAAKACISEILPSKFKPRLSAPSALLQEQKSILLPSEKAQSCENLCVSGSLNDSKRGLPLQVGGSIENLLMRSRRDYDSKSSSTMSLQEYSTSGRRPCPLSRKAGMQFTMLYRDMHQINRSGLFLGSISSSSSVRDLASHFEKSSLALSRGELGPSQEGSEHIPKHTVSSRITAFEQLIQRSRSMPSLDLSGRLSKSPTPVLSRGSLTSARSAESLLESTKLHPKEMDGMNSSGVYASPTCSNMAHHALSFRGLVPSEPLSTCSDDVDRCSNISTDSREGSGGSVHGDFPKHRLNKCKGTCPASYTRFTTIRKHEQQQTSRQPEWRLDARGDKSTLLRNIYLMSPLPFRLKKPLHHHPRQPSPGDSSGLLVGQKPDLPSQPHQDQPPSGGKPVVPTRLSSRHTMARLSRSSEPSQERPTALEDYPRAINNGNSVPYSDHSLDRNNNPQSELAPSRG (in isoform 12); 738..793; Missing (in isoform 4 and isoform 10); 795..799; MRPAR -> KYDWA (in isoform 7); 800..1292; Missing (in isoform 7); 955..1212; Missing (in isoform 4, isoform 5, isoform 6, isoform 8, isoform 9, isoform 10 and isoform 12); 955..1117; Missing (in isoform 2); 956..975; FSSHSKLITPAPSSLPHSRR -> LSHHSLRAGPDLTESEKSYV (in isoform 3); 976..1213; Missing (in isoform 3); 1213; Q -> QLSHHSLRAGPDLTESEKSYV (in isoform 11)

3D Structural Models

Turn

910..912; 1274..1276

Helix

844..846; 920..922

Beta Strand

796..802; 808..811; 819..825; 827..835; 838..843; 847..849; 863..865; 870..874; 882..885; 893..899; 901..908; 915..919; 923..927; 1230..1233; 1235..1240; 1257..1263; 1267..1273; 1279..1283; 1286..1289

3D Structure

NMR spectroscopy (5); X-ray crystallography (6)

Domain & Motif Annotations

Compositional Bias

74..89; Low complexity; 93..102; Basic and acidic residues; 114..128; Polar residues; 240..252; Pro residues; 266..275; Polar residues; 354..365; Basic and acidic residues; 437..450; Polar residues; 510..534; Basic and acidic residues; 944..954; Low complexity; 955..971; Polar residues; 1106..1117; Polar residues; 1119..1136; Basic and acidic residues; 1162..1172; Polar residues; 1192..1203; Basic and acidic residues; 1211..1230; Polar residues

Domain (FT)

366..469; SoHo; 793..852; SH3 1; 867..928; SH3 2; 1231..1292; SH3 3

Region

1..29; Disordered; 73..158; Disordered; 214..275; Disordered; 318..381; Disordered; 405..534; Disordered; 628..650; Disordered; 692..716; Disordered; 944..976; Disordered; 1041..1064; Disordered; 1106..1150; Disordered; 1162..1230; Disordered

Clinical Relevance4

Antibody (3)

HPA027559 CAB032850 HPA043084

Interaction Protein (2)

ENSG00000097007ENSG00000165458

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications2

PMID	Title	Abstract
35399949	Integration of Metabolomics and Proteomics in Exploring the Endothelial Dysfunction Mechanism Induced by Serum Exosomes From Diabetic Retinopathy and Diabetic Nephropathy Patients.	No abstract available
38716512	Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics.	No abstract available