Protein detail
S12A5
Solute carrier family 12 member 5 (Electroneutral potassium-chloride cotransporter 2) (K-Cl cotransporter 2) (hKCC2) (Neuronal K-Cl cotransporter)
Protein symbol S12A5 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 12 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Solute carrier family 12 member 5 (Electroneutral potassium-chloride cotransporter 2) (K-Cl cotransporter 2) (hKCC2) (Neuronal K-Cl cotransporter)
Protein Class
Disease related genesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Epilepsy
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Transmembrane
99..120; Discontinuously helical; Name=1; 130..151; Helical; Name=2; 175..203; Helical; Name=3; 230..250; Helical; Name=4; 251..276; Helical; Name=5; 403..420; Helical; Name=6; 430..453; Helical; Name=7; 486..513; Helical; Name=8; 535..555; Helical; Name=9; 556..578; Helical; Name=10; 593..615; Helical; Name=11; 616..632; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym
KCC2KIAA1176
Gene Description
Solute carrier family 12 member 5
Chromosome
20
Position
46021690-46060150
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Cell SpecificAstrocytesSingle-Nuclei Brain Specificendothelial cellBlood Cell Specificneutrophil
Function & Pathway
Protein Function
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Epilepsy
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- FDA approved drug targets:Small molecule drugs
Cellular Component
Molecular Function
Biological Process
Reactome
Mediation Categories
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
13 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC12A5 | STK39 | Q9UEW8 | T | 6 | phosphorylation | PhosphoSite_ProtMapperProtMapper | |
| SLC12A5 | STK39 | Q9UEW8 | T | 1,032 | phosphorylation | PhosphoSite_ProtMapperProtMapper | |
| SLC12A5 | STK39 | Q9UEW8 | T | 1,030 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:24567703ProtMapper:29092909ProtMapper:26142773 |
| SLC12A5 | STK39 | Q9UEW8 | T | 929 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24567703 |
| SLC12A5 | WNK3 | Q9BYP7 | T | 1,030 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24139641 |
| SLC12A5 | WNK3 | Q9BYP7 | T | 929 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24139641 |
| SLC12A5 | OXSR1 | O95747 | T | 1,030 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:24567703ProtMapper:26142773 |
| SLC12A5 | OXSR1 | O95747 | T | 929 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:24567703 |
| SLC12A5 | WNK1 | Q9H4A3 | T | 1,030 | phosphorylation | RLIMS-P_ProtMapperREACH_ProtMapperProtMapper | ProtMapper:27025876ProtMapper:29176664 |
| SLC12A5 | WNK1 | Q9H4A3 | T | 929 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:27025876 |
Page 1 of 2Next
Ligand-Receptor Signaling
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | No | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| WNK3 | Q9BYP7 | S12A5 | Q9H2X9 | Yes | No | Yes | REACH_ProtMapperSIGNORProtMapper | ProtMapper:24139641SIGNOR:21613606 |
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
1,139
Mass
126,184
Sequence
MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVKGDGNPKESSPFINSTDTEKGKEYDGKNMALFEEEMDTSPMVSSLLSGLANYTNLPQGSREHEEAENNEGGKKKPVQAPRMGTFMGVYLPCLQNIFGVILFLRLTWVVGIAGIMESFCMVFICCSCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTTFAGAMYILGTIEILLAYLFPAMAIFKAEDASGEAAAMLNNMRVYGTCVLTCMATVVFVGVKYVNKFALVFLGCVILSILAIYAGVIKSAFDPPNFPICLLGNRTLSRHGFDVCAKLAWEGNETVTTRLWGLFCSSRFLNATCDEYFTRNNVTEIQGIPGAASGLIKENLWSSYLTKGVIVERSGMTSVGLADGTPIDMDHPYVFSDMTSYFTLLVGIYFPSVTGIMAGSNRSGDLRDAQKSIPTGTILAIATTSAVYISSVVLFGACIEGVVLRDKFGEAVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAISRDGIVPFLQVFGHGKANGEPTWALLLTACICEIGILIASLDEVAPILSMFFLMCYMFVNLACAVQTLLRTPNWRPRFRYYHWTLSFLGMSLCLALMFICSWYYALVAMLIAGLIYKYIEYRGAEKEWGDGIRGLSLSAARYALLRLEEGPPHTKNWRPQLLVLVRVDQDQNVVHPQLLSLTSQLKAGKGLTIVGSVLEGTFLENHPQAQRAEESIRRLMEAEKVKGFCQVVISSNLRDGVSHLIQSGGLGGLQHNTVLVGWPRNWRQKEDHQTWRNFIELVRETTAGHLALLVTKNVSMFPGNPERFSEGSIDVWWIVHDGGMLMLLPFLLRHHKVWRKCKMRIFTVAQMDDNSIQMKKDLTTFLYHLRITAEVEVVEMHESDISAYTYEKTLVMEQRSQILKQMHLTKNEREREIQSITDESRGSIRRKNPANTRLRLNVPEETAGDSEEKPEEEVQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKGPSPVSSEGIKDFFSMKPEWENLNQSNVRRMHTAVRLNEVIVKKSRDAKLVLLNMPGPPRNRNGDENYMEFLEVLTEHLDRVMLVRGGGREVITIYS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=KCC2a; IsoId=Q9H2X9-1; Sequence=Displayed; Name=2; Synonyms=KCC2b; IsoId=Q9H2X9-2; Sequence=VSP_029909
Alternative Sequence
1..40; MSRRFTVTSLPPAGPARSPDPESRRHSVADPRHLPGEDVK -> MLNNLTDCEDGDGGANP (in isoform 2)
3D Structural Models
Turn
152..154; 156..162; 192..194; 300..302; 371..373; 477..479; 489..495; 521..524; 572..574; 577..579; 618..620; 757..760; 808..810; 904..906; 923..927; 946..948; 953..957; 1107..1110; 1118..1120
Helix
82..88; 99..102; 103..105; 122..125; 127..133; 137..141; 143..149; 163..177; 188..191; 198..201; 203..228; 245..270; 272..277; 279..299; 341..344; 356..359; 378..380; 423..430; 431..433; 437..441; 450..463; 466..476; 482..485; 500..502; 508..520; 525..538; 543..549; 559..567; 569..571; 581..605; 621..634; 638..644; 646..663; 667..681; 713..722; 738..741; 743..756; 773..782; 812..823; 834..836; 859..868; 894..903; 931..940; 1078..1087; 1104..1106; 1111..1117
Beta Strand
241..243; 308..314; 326..328; 332..334; 348..352; 364..369; 395..397; 412..414; 442..446; 503..505; 555..558; 614..616; 664..666; 685..687; 688..691; 698..700; 729..736; 763..772; 793..796; 803..806; 827..832; 850..852; 854..856; 871..876; 880..885; 887..889; 910..915; 949..951; 1088..1091; 1093..1096; 1122..1128
3D Structure
Electron microscopy (2)
Domain & Motif Annotations
Compositional Bias
19..45; Basic and acidic residues; 46..55; Polar residues; 98..111; Basic and acidic residues; 945..962; Basic and acidic residues; 982..994; Acidic residues; 1003..1012; Low complexity; 1023..1042; Basic and acidic residues
Region
1..63; Disordered; 92..116; Disordered; 667..681; Scissor helix; 942..1052; Disordered
Protein Families
- SLC12A transporter family
- K/Cl co-transporter subfamily
Sequence Similarities
Belongs to the SLC12A transporter family. K/Cl co-transporter subfamily.
Clinical Relevance
Disease Involvement
Disease variantEpilepsyFDA approved drug targets
Related Diseases
Biomarker
Investigative
Drug Targets
FDA approved drug targets
Drugs
Antibody