Protein detail
E41L1
Band 4.1-like protein 1 (Erythrocyte membrane protein band 4.1-like 1) (Neuronal protein 4.1) (4.1N)
Entry name E41L1 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 14 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Band 4.1-like protein 1 (Erythrocyte membrane protein band 4.1-like 1) (Neuronal protein 4.1) (4.1N)
Protein Class (3)
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
4.1NKIAA0338
Gene Description
Erythrocyte membrane protein band 4.1 like 1
Chromosome
20
Position
36091504-36232799
Supporting publications (n)
14
EVMP confidence score
0.72
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificcDCSingle-Nuclei Brain SpecificleukocyteBlood Cell Specificbasophil
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
Reactome (9)
- R-hsa-6794361 neurexins and neuroligins
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-6794362 protein protein interactions at synapses
- R-hsa-9709957 sensory perception
- R-hsa-9659379 sensory processing of sound
- R-hsa-9662361 sensory processing of sound by outer hair cells of the cochlea
- R-hsa-399719 trafficking of ampa receptors
- R-hsa-112315 transmission across chemical synapses
Mediation Categories
Fusion and delivery mediation
Relations & Evidence18
Enzyme-Mediated Modification (7)
7 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| EPB41L1 | CDK1 | P06493 | T | 475 | phosphorylation | KEA | KEA:17570479 |
| EPB41L1 | CDK1 | P06493 | T | 550 | phosphorylation | KEA | KEA:17570479 |
| EPB41L1 | CDK2 | P24941 | S | 546 | phosphorylation | KEA | KEA:17570479 |
| EPB41L1 | GSK3B | P49841 | T | 550 | phosphorylation | KEA | KEA:17570479 |
| EPB41L1 | MAPK14 | Q16539 | T | 475 | phosphorylation | KEA | KEA:17570479 |
| EPB41L1 | MAPK14 | Q16539 | T | 550 | phosphorylation | KEA | KEA:17570479 |
| EPB41L1 | RPS6KA3 | P51812 | S | 648 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellChatDB | Yes | ||||
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| ferm_domain | intracellular_intercellular_related | HGNC | Yes | ||||
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass Spectrometry | 1 | 38037300 |
Sequence, Structure & Domains
Sequences
Length
881
Mass
98,503
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9H4G0-1; Sequence=Displayed; Name=2; IsoId=Q9H4G0-2; Sequence=VSP_023958, VSP_023961, VSP_023963; Name=3; IsoId=Q9H4G0-3; Sequence=VSP_023958, VSP_023960, VSP_023961; Name=4; IsoId=Q9H4G0-4; Sequence=VSP_023959, VSP_023961, VSP_023962
Alternative Sequence
1..62; Missing (in isoform 2 and isoform 3); 1..59; MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQ -> MVFLGRINEVEPAKGLAESLAPTERSVK (in isoform 4); 115..149; Missing (in isoform 3); 484..495; Missing (in isoform 2, isoform 3 and isoform 4); 556..692; Missing (in isoform 4); 729..756; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
17..35; Low complexity; 38..50; Basic and acidic residues; 76..87; Polar residues; 444..457; Basic and acidic residues; 466..501; Basic and acidic residues; 514..538; Basic and acidic residues; 550..577; Basic and acidic residues
Domain (FT)
97..378; FERM
Region
1..88; Disordered; 428..501; Disordered; 483..541; Spectrin--actin-binding; 514..596; Disordered; 642..699; Disordered; 746..881; C-terminal (CTD)
Clinical Relevance
Disease Involvement (2)
Disease variantIntellectual disability
Related Diseases
Interaction Protein
ENSG00000074201
Interaction Count
1
Interaction Dataset
biogrid_opencell
Supporting Publications14
| PMID | Title | Related sentences |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No related sentences available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 32916986 | Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines. | No related sentences available |
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No related sentences available |
| 33441949 | Utility of Claudin-3 in extracellular vesicles from human bile as biomarkers of cholangiocarcinoma. | No related sentences available |
| 34473505 | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. | Column-based Technology for CD9-HPLC Immunoaffinity Isolation of Serum Extracellular Vesicles. |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |
| 37563857 | Comprehensive characterization of human brain-derived extracellular vesicles using multiple isolation methods: Implications for diagnostic and therapeutic applications. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
Page 1 of 2Next