Protein detail

E41L1

Band 4.1-like protein 1 (Erythrocyte membrane protein band 4.1-like 1) (Neuronal protein 4.1) (4.1N)

Entry name E41L1	UniProt ID Q9H4G0	EVMP confidence score 0.60
Supporting publications (n) 14	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Band 4.1-like protein 1 (Erythrocyte membrane protein band 4.1-like 1) (Neuronal protein 4.1) (4.1N)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins

Ensembl

ENSG00000088367

Entrez Gene Symbol

EPB41L1

Gene Synonym (2)

4.1NKIAA0338

Gene Description

Erythrocyte membrane protein band 4.1 like 1

Chromosome

Position

36091504-36232799

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization4

Tissue Specificlymphoid tissueCell SpecificcDCSingle-Nuclei Brain SpecificleukocyteBlood Cell Specificbasophil

Function & Pathway7

Protein Function (3)

Disease related genes
Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins

Cellular Component (3)

Molecular Function (3)

Biological Process (3)

KEGG

hsa04517 IgSF CAM signaling

Reactome (9)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence18

Enzyme-Mediated Modification (7)

7 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
EPB41L1	CDK1	P06493	T	475	phosphorylation	KEA	KEA:17570479
EPB41L1	CDK1	P06493	T	550	phosphorylation	KEA	KEA:17570479
EPB41L1	CDK2	P24941	S	546	phosphorylation	KEA	KEA:17570479
EPB41L1	GSK3B	P49841	T	550	phosphorylation	KEA	KEA:17570479
EPB41L1	MAPK14	Q16539	T	475	phosphorylation	KEA	KEA:17570479
EPB41L1	MAPK14	Q16539	T	550	phosphorylation	KEA	KEA:17570479
EPB41L1	RPS6KA3	P51812	S	648	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellChatDB	No	Yes	No	No	No
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
ferm_domain	intracellular_intercellular_related	HGNC	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	EPB41L1 NOP16	Q9H4G0 Q9Y3C1	0:0	Havugimana2012	Havugimana2012:C_49

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass Spectrometry	1	38037300

Sequence, Structure & Domains8

Sequences

Length

881

Mass

98,503

Sequence

MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQSLDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKRDEDGESGGQRSEAEEGEVRTPTKIKELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPSSPASPSPKGTPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDTVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSDTEGLLFSRDLNKGAPSQDDESGGIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTRVSAMDNTQQVDGSASVGREFIATTPSITTETISTTMENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9H4G0-1; Sequence=Displayed; Name=2; IsoId=Q9H4G0-2; Sequence=VSP_023958, VSP_023961, VSP_023963; Name=3; IsoId=Q9H4G0-3; Sequence=VSP_023958, VSP_023960, VSP_023961; Name=4; IsoId=Q9H4G0-4; Sequence=VSP_023959, VSP_023961, VSP_023962

Alternative Sequence

1..62; Missing (in isoform 2 and isoform 3); 1..59; MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHPSQQDTRPAEQ -> MVFLGRINEVEPAKGLAESLAPTERSVK (in isoform 4); 115..149; Missing (in isoform 3); 484..495; Missing (in isoform 2, isoform 3 and isoform 4); 556..692; Missing (in isoform 4); 729..756; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

17..35; Low complexity; 38..50; Basic and acidic residues; 76..87; Polar residues; 444..457; Basic and acidic residues; 466..501; Basic and acidic residues; 514..538; Basic and acidic residues; 550..577; Basic and acidic residues

Domain (FT)

97..378; FERM

Region

1..88; Disordered; 428..501; Disordered; 483..541; Spectrin--actin-binding; 514..596; Disordered; 642..699; Disordered; 746..881; C-terminal (CTD)

Clinical Relevance5

Disease Involvement (2)

Disease variantIntellectual disability

Antibody (2)

HPA054104 HPA056817

Interaction Protein

ENSG00000074201

Interaction Count

Interaction Dataset

biogrid_opencell

Supporting Publications14

PMID	Title	Abstract
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
40940449	Extracellular vesicle-associated transcriptomic and proteomic biomarkers show in vitro potential for vandetanib treatment monitoring in anaplastic thyroid cancer.	No abstract available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No abstract available

Page 2 of 2Previous