Protein detail

ANTR1

Anthrax toxin receptor 1 (Tumor endothelial marker 8)

Entry name ANTR1	UniProt ID Q9H6X2	EVMP confidence score 0.25
Supporting publications (n) 4	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Anthrax toxin receptor 1 (Tumor endothelial marker 8)

Protein Function (3)

Disease related genes
Human disease related genes:Cardiovascular diseases:Vascular diseases
Predicted intracellular proteins

Transmembrane

322..342; Helical

Transmembrane Count

Ensembl

ENSG00000169604

Entrez Gene Symbol

ANTXR1

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway8

Protein Function (3)

Disease related genes
Human disease related genes:Cardiovascular diseases:Vascular diseases
Predicted intracellular proteins

Cellular Component (6)

Molecular Function (5)

Biological Process (3)

KEGG

hsa04621 NOD-like receptor signaling pathway

Reactome (4)

Canonical Pathways (3)

M26 Pid nfkappab atypical pathway
M17200 Sa b cell receptor complexes
M63 Pid avb3 opn pathway

Mediation Categories (3)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediation

Relations & Evidence40

Ligand-Receptor Signaling (35)

35 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
matrix_adhesion	matrix_adhesion	OmniPath	No	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	LOCATE	No	No	No	Yes	No

Page 2 of 4Previous Next

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ANTXR1 B4GALNT4 DNAJC12 INSL5 TPH1	P17752 Q76KP1 Q9H6X2 Q9UKB3 Q9Y5Q6	0:0:0:0:0	hu.MAP2
ANTXR1 DNAJC12 TPH1	P17752 Q9H6X2 Q9UKB3	0:0:0	hu.MAP2
ANTXR1 B4GALNT4	Q76KP1 Q9H6X2	0:0	hu.MAP
ANTXR1	Q9H6X2	6	PDB	PDB:3n2n

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass Spectrometry	2	38113368 38207106

Sequence, Structure & Domains14

Sequences

Length

564

Mass

62,789

Sequence

MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPPAEESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGRCINFTRVKNNQPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRPSV

Alternative Products

Event=Alternative splicing; Named isoforms=6; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; IsoId=Q9H6X2-1; Sequence=Displayed; Name=2; IsoId=Q9H6X2-2; Sequence=VSP_000444, VSP_000445; Name=3; IsoId=Q9H6X2-3; Sequence=VSP_000446, VSP_000447; Name=4; IsoId=Q9H6X2-4; Sequence=VSP_000448, VSP_000449; Name=5; Synonyms=V4; IsoId=Q9H6X2-5; Sequence=VSP_047865; Name=6; Synonyms=V5; IsoId=Q9H6X2-6; Sequence=VSP_047863, VSP_047864

Alternative Sequence

268..297; NEKPFSVEDTYLLCPAPILKEVGMKAALQV -> SKSLQSPWVSSTSGFKEGNSHPCLPARPHT (in isoform 3); 298..564; Missing (in isoform 3); 315..358; THCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPP -> FHPSPSSPGSTSQQGTSSLPPSSKAFCLEPKVPALGSLRNFRRC (in isoform 6); 319..333; DGSILAIALLILFLL -> LHKIASGPTTAACME (in isoform 4); 334..564; Missing (in isoform 4); 359..564; Missing (in isoform 6); 365..368; EDDD -> NKIK (in isoform 2); 369..564; Missing (in isoform 2); 522..557; Missing (in isoform 5)

3D Structural Models

Turn

189..191

Helix

53..58; 59..72; 99..110; 120..135; 155..170; 185..188; 195..197; 201..217

Beta Strand

40..50; 78..96; 141..149; 173..179; 192..194; 198..200

3D Structure

Electron microscopy (4); X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

402..422; Basic and acidic residues; 505..564; Pro residues

Domain (FT)

44..215; VWFA

Region

154..160; Interaction with PA; 356..375; Disordered; 402..444; Disordered; 493..564; Disordered

Protein Families

ATR family

Sequence Similarities

Belongs to the ATR family.

Clinical Relevance3

Interaction Protein

ENSG00000100652

Interaction Count

Interaction Dataset

biogrid_bioplex

Supporting Publications4

PMID	Title	Abstract
36982312	Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
39873726	Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer.	No abstract available
41201090	Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma.	No abstract available