Protein detail
ANTR1
Anthrax toxin receptor 1 (Tumor endothelial marker 8)
Entry name ANTR1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Anthrax toxin receptor 1 (Tumor endothelial marker 8)
Protein Function (3)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Predicted intracellular proteins
Transmembrane
322..342; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
4
EVMP confidence score
0.53
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Vascular diseases
- Predicted intracellular proteins
Cellular Component (6)
Molecular Function (5)
Biological Process (3)
Reactome (4)
Canonical Pathways (3)
- M26 Pid nfkappab atypical pathway
- M17200 Sa b cell receptor complexes
- M63 Pid avb3 opn pathway
Mediation Categories (3)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediation
Relations & Evidence40
Ligand-Receptor Signaling (35)
35 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes |
Protein Complex Composition (4)
Sequence, Structure & Domains
Sequences
Length
564
Mass
62,789
Sequence
MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDREQIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTDGELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHARNVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMNDGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPPAEESEEEDDDGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRKWYSPIKGKLDALWVLLRKGYDRVSVMRPQPGDTGRCINFTRVKNNQPAKYPLNNAYHTSSPPPAPIYTPPPPAPHCPPPPPSAPTPPIPSPPSTLPPPPQAPPPNRAPPPSRPPPRPSV
Alternative Products
Event=Alternative splicing; Named isoforms=6; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; IsoId=Q9H6X2-1; Sequence=Displayed; Name=2; IsoId=Q9H6X2-2; Sequence=VSP_000444, VSP_000445; Name=3; IsoId=Q9H6X2-3; Sequence=VSP_000446, VSP_000447; Name=4; IsoId=Q9H6X2-4; Sequence=VSP_000448, VSP_000449; Name=5; Synonyms=V4; IsoId=Q9H6X2-5; Sequence=VSP_047865; Name=6; Synonyms=V5; IsoId=Q9H6X2-6; Sequence=VSP_047863, VSP_047864
Alternative Sequence
268..297; NEKPFSVEDTYLLCPAPILKEVGMKAALQV -> SKSLQSPWVSSTSGFKEGNSHPCLPARPHT (in isoform 3); 298..564; Missing (in isoform 3); 315..358; THCSDGSILAIALLILFLLLALALLWWFWPLCCTVIIKEVPPPP -> FHPSPSSPGSTSQQGTSSLPPSSKAFCLEPKVPALGSLRNFRRC (in isoform 6); 319..333; DGSILAIALLILFLL -> LHKIASGPTTAACME (in isoform 4); 334..564; Missing (in isoform 4); 359..564; Missing (in isoform 6); 365..368; EDDD -> NKIK (in isoform 2); 369..564; Missing (in isoform 2); 522..557; Missing (in isoform 5)
3D Structural Models
Turn
189..191
Helix
53..58; 59..72; 99..110; 120..135; 155..170; 185..188; 195..197; 201..217
Beta Strand
40..50; 78..96; 141..149; 173..179; 192..194; 198..200
3D Structure
Electron microscopy (4); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
402..422; Basic and acidic residues; 505..564; Pro residues
Domain (FT)
44..215; VWFA
Region
154..160; Interaction with PA; 356..375; Disordered; 402..444; Disordered; 493..564; Disordered
Protein Families
ATR family
Sequence Similarities
Belongs to the ATR family.
Clinical Relevance
Interaction Protein
ENSG00000100652
Interaction Count
1
Interaction Dataset
biogrid_bioplex
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 36982312 | Saliva and Saliva Extracellular Vesicles for Biomarker Candidate Identification-Assay Development and Pilot Study in Amyotrophic Lateral Sclerosis. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No related sentences available |
| 41201090 | Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma. | No related sentences available |