Protein detail

SYNCI

Syncoilin (Syncoilin intermediate filament 1) (Syncoilin-1)

Entry name SYNCI	UniProt ID Q9H7C4	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Syncoilin (Syncoilin intermediate filament 1) (Syncoilin-1)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000162520

Entrez Gene Symbol

SYNC

Gene Synonym (2)

SYNC1SYNCOILIN

Gene Description

Syncoilin, intermediate filament protein

Chromosome

Position

32679906-32703596

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Cell SpecificAstrocytes

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence38

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (33)

33 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
C-to-U editosome complex	A1CF APOBEC1 HNRNPAB SYNCRIP	O60506 P41238 Q99729 Q9NQ94	1:2:1:1	ComplexPortal	intact:EBI-13951908	8999813 11727199 12881431 14755292 11352648 11134005 21496894
CRD-mediated mRNA stability complex	DHX9 HNRNPU IGF2BP1 SYNCRIP YBX1	O60506 P67809 Q00839 Q08211 Q9NZI8	1:1:1:1:1	CompleatComplexPortal	Compleat:HC3342	19029303 12024010 23640942 11278713 14755292
HT_DM_Cluster52	CHTOP HNRNPR KHDRBS1 KHDRBS2 KHDRBS3 MOV10 PABPC1 PABPC1L PABPC1L2A PABPC4 PABPC4L PABPC5 PUF60 RBM15 RBM15B RBM47 RBMS1 RBMS2 RBMS3 SART3 SF1 SYNCRIP	A0AV96 O43390 O60506 O75525 P0CB38 P11940 P29558 Q07666 Q13310 Q15020 Q15434 Q15637 Q4VXU2 Q5JQF8 Q5VWX1 Q6XE24 Q8NDT2 Q96DU9 Q96T37 Q9HCE1 Q9UHX1 Q9Y3Y2	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC1454	22036573
IGF2BP1 complex	DHX9 ELAVL1 HNRNPU IGF2BP1 RPL26 RPS6 STAU1 SYNCRIP YBX1	O60506 O95793 P61254 P62753 P67809 Q00839 Q08211 Q15717 Q9NZI8	0:0:0:0:0:0:0:0:0	CORUM	CORUM:6838	19029303
	FAM120A MAP3K4 SYNCRIP TBC1D10B WDR91	A4D1P6 O60506 Q4KMP7 Q9NZB2 Q9Y6R4	0:0:0:0:0	hu.MAP
	CDK11B KHDRBS1 KHDRBS2 KHDRBS3 MOV10 PABPC1 PRMT1 PUF60 SAP30BP SUPT5H SYNCRIP	O00267 O60506 O75525 P11940 P21127 Q07666 Q5VWX1 Q99873 Q9HCE1 Q9UHR5 Q9UHX1	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4394
	DES INA NEFH NEFL NEFM NES SPATA22 SYNC SYNM VIM XPNPEP3	O15061 P07196 P07197 P08670 P12036 P17661 P48681 Q16352 Q8NHS9 Q9H7C4 Q9NQH7	0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
	PRPH SYNC SYNM	O15061 P41219 Q9H7C4	0:0:0	hu.MAP2
	HNRNPA1 HNRNPK HNRNPR KHDRBS1 KHDRBS2 KHDRBS3 MOV10 PABPC1 PRMT1 PUF60 RAB5A SYNCRIP TM9SF4	O43390 O60506 O75525 P09651 P11940 P20339 P61978 Q07666 Q5VWX1 Q92544 Q99873 Q9HCE1 Q9UHX1	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4068
	CEBPG HNRNPA1 HNRNPK HNRNPR KHDRBS1 KHDRBS2 KHDRBS3 MOV10 MRTO4 PABPC1 PRMT1 PUF60 SYNCRIP	O43390 O60506 O75525 P09651 P11940 P53567 P61978 Q07666 Q5VWX1 Q99873 Q9HCE1 Q9UHX1 Q9UKD2	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7718

Page 1 of 4Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometryWestern blotting	0

Sequence, Structure & Domains10

Sequences

Length

482

Mass

55,299

Sequence

MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDEALHVEEPGNPEETVCVEETTEPDRIQFVEGPVEPGKPTSPEHVVYEGETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQEVQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQLECRQQDVAQFADFREVLTTRATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H7C4-1; Sequence=Displayed; Name=2; IsoId=Q9H7C4-2; Sequence=VSP_039404

Alternative Sequence

454..482; AMLLPKSLEQADAPTSQAGGMETQSQGAV -> GCLEIYGQICNPETAKNFLAKDH (in isoform 2)

Domain & Motif Annotations

Compositional Bias

1..10; Basic and acidic residues; 144..156; Basic and acidic residues; 466..482; Polar residues

Domain (FT)

168..463; IF rod

Region

1..161; Head; 1..42; Disordered; 144..165; Disordered; 170..204; Coil 1A; 205..231; Linker 1; 232..309; Coil 1b; 310..349; Linker 2; 350..458; Coil 2; 459..482; Tail; 460..482; Disordered

Protein Families

Intermediate filament family

Sequence Similarities

Belongs to the intermediate filament family.

Clinical Relevance4

Antibody (2)

HPA028311 HPA063549

Interaction Protein

ENSG00000026025

Interaction Count

Interaction Dataset

intact_biogrid_opencell

Supporting Publications1

PMID	Title	Abstract
29045505	Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients.	Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers.