Protein detail

SYNCI

Syncoilin (Syncoilin intermediate filament 1) (Syncoilin-1)

Entry name SYNCI	UniProt ID Q9H7C4	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Syncoilin (Syncoilin intermediate filament 1) (Syncoilin-1)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000162520

Entrez Gene Symbol

SYNC

Gene Synonym (2)

SYNC1SYNCOILIN

Gene Description

Syncoilin, intermediate filament protein

Chromosome

Position

32679906-32703596

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Cell SpecificAstrocytes

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence38

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (33)

33 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
HNRNPA1 HNRNPK HNRNPR KHDRBS1 KHDRBS2 KHDRBS3 MORF4L1 MOV10 PABPC1 PRMT1 PUF60 SLC25A30 SYNCRIP	O43390 O60506 O75525 P09651 P11940 P61978 Q07666 Q5SVS4 Q5VWX1 Q99873 Q9HCE1 Q9UBU8 Q9UHX1	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4941
DDX17 DDX5 HNRNPA1 HNRNPA2B1 HNRNPR KHDRBS2 MEPCE PRMT1 SYNCRIP TOP1 YLPM1	O43390 O60506 P09651 P11387 P17844 P22626 P49750 Q5VWX1 Q7L2J0 Q92841 Q99873	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9828
HNRNPA2B1 HNRNPA3 HNRNPK HNRNPR KHDRBS2 PPWD1 PRMT1 SYNCRIP	O43390 O60506 P22626 P51991 P61978 Q5VWX1 Q96BP3 Q99873	0:0:0:0:0:0:0:0	hu.MAP
ACO1 FAR2 HECW2 KHDRBS1 KHDRBS2 KHDRBS3 MOV10 PUF60 SYNCRIP VPS51	O60506 O75525 P21399 Q07666 Q5VWX1 Q96K12 Q9HCE1 Q9P2P5 Q9UHX1 Q9UID3	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7634
CSDE1 HNRNPD PABPC1 PCLAF PUF60 SNW1 SYNCRIP	O60506 O75534 P11940 Q13573 Q14103 Q15004 Q9UHX1	1:1:1:1:1:1:1	CompleatCFinder	Compleat:HC5042
GAA IGF2BP1 ILF3 LETM1 LRRC59 NCLN NUP35 RPN1 RPN2 STT3B SYNCRIP	O60506 O95202 P04843 P04844 P10253 Q12906 Q8NFH5 Q8TCJ2 Q969V3 Q96AG4 Q9NZI8	0:0:0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_598
AIMP1 AIMP2 DARS1 EPRS1 HECW2 IARS1 JKAMP KARS1 MARS1 QARS1 RARS1 SYNCRIP	O60506 P07814 P14868 P41252 P47897 P54136 P56192 Q12904 Q13155 Q15046 Q9P055 Q9P2P5	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3651
CMTR2 DYNC1H1 ILF2 KHDRBS1 PRPF19 SFPQ SNRNP70 SNRPA SNRPA1 SNRPB2 SNRPD1 SNRPD2 SNRPD3 SNRPE SNRPG SYNCRIP	O60506 P08579 P08621 P09012 P09661 P23246 P62304 P62308 P62314 P62316 P62318 Q07666 Q12905 Q14204 Q8IYT2 Q9UMS4	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
HNRNPA1 HNRNPK KHDRBS1 KHDRBS2 PABPC1 PRMT1 SMAD1 SREK1 SRSF3 SYNCRIP VPS51	O60506 P09651 P11940 P61978 P84103 Q07666 Q15797 Q5VWX1 Q8WXA9 Q99873 Q9UID3	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5430
CUX1 HNRNPA0 HNRNPA1 HNRNPA2B1 HNRNPA3 HNRNPF HNRNPH1 HNRNPH2 HNRNPK MTREX SYNCRIP	O60506 P09651 P22626 P31943 P39880 P42285 P51991 P52597 P55795 P61978 Q13151	0:0:0:0:0:0:0:0:0:0:0	hu.MAP

Page 2 of 4Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometryWestern blotting	0

Sequence, Structure & Domains10

Sequences

Length

482

Mass

55,299

Sequence

MASPEPRRGGDGAAQAARKTRVEANSPLPKNSGSLNEAEALNPEVTLSSEGSLNLEDILYLEDTGDLDETLYVQETEKAEEALYIEEAMQPDEALHVEEPGNPEETVCVEETTEPDRIQFVEGPVEPGKPTSPEHVVYEGETVTRAEKSNPEESLRAEQSPSMEENLSIEDLELLEGRFQQCVQAVAQLEEERDQLIHELVLLREPALQEVQQVHQDILAAYKLHAQAELERDGLREEIRLVKQKLFKVTKECVAYQYQLECRQQDVAQFADFREVLTTRATQLSEELAQLRDAYQKQKEQLRQQLEAPPSQRDGHFLQESRRLSAQFENLMAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9H7C4-1; Sequence=Displayed; Name=2; IsoId=Q9H7C4-2; Sequence=VSP_039404

Alternative Sequence

454..482; AMLLPKSLEQADAPTSQAGGMETQSQGAV -> GCLEIYGQICNPETAKNFLAKDH (in isoform 2)

Domain & Motif Annotations

Compositional Bias

1..10; Basic and acidic residues; 144..156; Basic and acidic residues; 466..482; Polar residues

Domain (FT)

168..463; IF rod

Region

1..161; Head; 1..42; Disordered; 144..165; Disordered; 170..204; Coil 1A; 205..231; Linker 1; 232..309; Coil 1b; 310..349; Linker 2; 350..458; Coil 2; 459..482; Tail; 460..482; Disordered

Protein Families

Intermediate filament family

Sequence Similarities

Belongs to the intermediate filament family.

Clinical Relevance4

Antibody (2)

HPA028311 HPA063549

Interaction Protein

ENSG00000026025

Interaction Count

Interaction Dataset

intact_biogrid_opencell

Supporting Publications1

PMID	Title	Abstract
29045505	Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients.	Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers.