Protein detail

S10AE

Protein S100-A14 (S100 calcium-binding protein A14) (S114)

Entry name S10AE	UniProt ID Q9HCY8	EVMP confidence score 0.60
Supporting publications (n) 18	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein S100-A14 (S100 calcium-binding protein A14) (S114)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000189334

Entrez Gene Symbol

S100A14

Gene Synonym (2)

BCMP84S100A15

Gene Description

S100 calcium binding protein A14

Chromosome

Position

153614255-153616986

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization1

Cell SpecificEnterocytes

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function (4)

Biological Process (3)

KEGG

hsa04382 Cornified envelope formation

Mediation Categories (2)

Immune mediationMetabolism mediation

Relations & Evidence13

Ligand-Receptor Signaling (10)

10 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	LOCATE	No	No	Yes	No	No
intracellular	intracellular	ComPPI	No	No	Yes	No	No
intracellular	intracellular	GO_Intercell	No	No	Yes	No	No
intracellular	intracellular	UniProt_location	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
secreted	secreted	Matrisome	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
ligand	ligand	Matrisome	Yes	No	Yes	No	No
ligand	ligand	OmniPath	Yes	No	Yes	No	No

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ARG1 S100A14 S100A16	P05089 Q96FQ6 Q9HCY8	0:0:0	hu.MAP
	S100A14	Q9HCY8	2	PDB	PDB:2m0r

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometryR Sequencing	1	35029059

Sequence, Structure & Domains10

Sequences

Length

104

Mass

11,662

Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

3D Structural Models

Turn

34..39; 55..57

Helix

19..32; 43..53; 60..62; 65..71; 81..94

Beta Strand

8..11; 98..100

3D Structure

NMR spectroscopy (1)

Domain & Motif Annotations

Domain (FT)

27..61; EF-hand

Protein Families

S-100 family

Sequence Similarities

Belongs to the S-100 family.

Clinical Relevance1

Antibody

HPA027613

Supporting Publications18

PMID	Title	Abstract
21630462	Proteomic analysis of microvesicles derived from human colorectal cancer ascites.	No abstract available
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No abstract available
28986585	Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics.	No abstract available
29045505	Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients.	Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers.
29436780	Autosomal Tubulointerstitial Kidney Disease-MUC1 Type: Differential Proteomics Suggests that Mutated MUC1 (insC) Affects Vesicular Transport in Renal Epithelial Cells.	No abstract available
30379855	Harmonization of exosome isolation from culture supernatants for optimized proteomics analysis.	No abstract available
30950185	Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer.	No abstract available
31941606	The role of actinin-4 (ACTN4) in exosomes as a potential novel therapeutic target in castration-resistant prostate cancer.	No abstract available
32284825	Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine.	No abstract available
34571828	Proteomic Analysis of Circulating Extracellular Vesicles Identifies Potential Biomarkers for Lymph Node Metastasis in Oral Tongue Squamous Cell Carcinoma.	No abstract available

Page 1 of 2Next