Protein detail

S10AE

Protein S100-A14 (S100 calcium-binding protein A14) (S114)

Entry name S10AE	UniProt ID Q9HCY8	EVMP confidence score 0.60
Supporting publications (n) 18	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein S100-A14 (S100 calcium-binding protein A14) (S114)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000189334

Entrez Gene Symbol

S100A14

Gene Synonym (2)

BCMP84S100A15

Gene Description

S100 calcium binding protein A14

Chromosome

Position

153614255-153616986

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization1

Cell SpecificEnterocytes

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function (4)

Biological Process (3)

KEGG

hsa04382 Cornified envelope formation

Mediation Categories (2)

Immune mediationMetabolism mediation

Relations & Evidence13

Ligand-Receptor Signaling (10)

10 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	LOCATE	No	No	Yes	No	No
intracellular	intracellular	ComPPI	No	No	Yes	No	No
intracellular	intracellular	GO_Intercell	No	No	Yes	No	No
intracellular	intracellular	UniProt_location	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
secreted	secreted	Matrisome	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
ligand	ligand	Matrisome	Yes	No	Yes	No	No
ligand	ligand	OmniPath	Yes	No	Yes	No	No

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ARG1 S100A14 S100A16	P05089 Q96FQ6 Q9HCY8	0:0:0	hu.MAP
	S100A14	Q9HCY8	2	PDB	PDB:2m0r

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometryR Sequencing	1	35029059

Sequence, Structure & Domains10

Sequences

Length

104

Mass

11,662

Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

3D Structural Models

Turn

34..39; 55..57

Helix

19..32; 43..53; 60..62; 65..71; 81..94

Beta Strand

8..11; 98..100

3D Structure

NMR spectroscopy (1)

Domain & Motif Annotations

Domain (FT)

27..61; EF-hand

Protein Families

S-100 family

Sequence Similarities

Belongs to the S-100 family.

Clinical Relevance1

Antibody

HPA027613

Supporting Publications18

PMID	Title	Abstract
34817906	Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform.	No abstract available
35611462	Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients.	No abstract available
36612172	Extracellular Vesicle Membrane Protein Profiling and Targeted Mass Spectrometry Unveil CD59 and Tetraspanin 9 as Novel Plasma Biomarkers for Detection of Colorectal Cancer.	No abstract available
37786918	Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.	No abstract available
38168906	Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis.	No abstract available
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No abstract available
39409015	SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy.	No abstract available
40089067	Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells.	No abstract available

Page 2 of 2Previous