Protein detail
S10AE
Protein S100-A14 (S100 calcium-binding protein A14) (S114)
Entry name S10AE | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 18 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein S100-A14 (S100 calcium-binding protein A14) (S114)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
BCMP84S100A15
Gene Description
S100 calcium binding protein A14
Chromosome
1
Position
153614255-153616986
Supporting publications (n)
18
EVMP confidence score
0.60
Fluorescence & Localization
Cell SpecificEnterocytes
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (4)
Biological Process (3)
Mediation Categories (2)
Immune mediationMetabolism mediation
Relations & Evidence13
Ligand-Receptor Signaling (10)
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| secreted | secreted | Matrisome | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| ligand | ligand | Matrisome | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryR Sequencing | 1 | 35029059 |
Sequence, Structure & Domains
Sequences
Length
104
Mass
11,662
Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
3D Structural Models
Turn
34..39; 55..57
Helix
19..32; 43..53; 60..62; 65..71; 81..94
Beta Strand
8..11; 98..100
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Domain (FT)
27..61; EF-hand
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Clinical Relevance
Antibody
Supporting Publications18
| PMID | Title | Related sentences |
|---|---|---|
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 36612172 | Extracellular Vesicle Membrane Protein Profiling and Targeted Mass Spectrometry Unveil CD59 and Tetraspanin 9 as Novel Plasma Biomarkers for Detection of Colorectal Cancer. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39409015 | SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy. | No related sentences available |
| 40089067 | Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells. | No related sentences available |
Page 2 of 2Previous