Protein detail
LIN7C
Protein lin-7 homolog C (Lin-7C) (Mammalian lin-seven protein 3) (MALS-3) (Vertebrate lin-7 homolog 3) (Veli-3)
Entry name LIN7C | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Protein lin-7 homolog C (Lin-7C) (Mammalian lin-seven protein 3) (MALS-3) (Vertebrate lin-7 homolog 3) (Veli-3)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
FLJ11215LIN-7-CLIN-7CMALS-3VELI3
Gene Description
Lin-7 homolog C, crumbs cell polarity complex component
Chromosome
11
Position
27494418-27506769
EVMP confidence score
0.38
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (10)
Molecular Function (5)
Reactome (9)
- R-hsa-442755 activation of nmda receptors and postsynaptic events
- R-hsa-9609736 assembly and cell surface presentation of nmda receptors
- R-hsa-212676 dopamine neurotransmitter release cycle
- R-hsa-6794361 neurexins and neuroligins
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-112310 neurotransmitter release cycle
- R-hsa-6794362 protein protein interactions at synapses
- R-hsa-112315 transmission across chemical synapses
Mediation Categories
Fusion and delivery mediation
Relations & Evidence28
Ligand-Receptor Signaling (19)
19 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | Baccin2019 | No | Yes | Yes | No | No |
| receptor | receptor | OmniPath | No | Yes | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | Baccin2019 | Yes | No | Yes | No | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | Yes | No | No |
| tight_junction | tight_junction | GO_Intercell | Yes | Yes | Yes | No | No |
| tight_junction | tight_junction | OmniPath | Yes | Yes | Yes | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | No |
Page 1 of 2Next
Protein Complex Composition (8)
8 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CASK-Mint1-Veli complex | APBA1CASKLIN7C | O14936Q02410Q9NUP9 | 1:1:1 | CORUMSIGNORCompleatComplexPortal | SIGNOR:SIGNOR-C561intact:EBI-42473580CORUM:617Compleat:HC917 | 1586361710846156147552929822620 |
| CASKLIN7BLIN7CMPDZ | O14936O75970Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP | |||
| APBA1CASKLIN7BLIN7C | O14936Q02410Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP | |||
| CASKLIN7BLIN7CMPP3 | O14936Q13368Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP | |||
| CASKLIN7BLIN7CMPP2 | O14936Q14168Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP | |||
| CASKKIF26BLIN7BLIN7C | O14936Q2KJY2Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP | |||
| ABLIM2CASKLIN7BLIN7C | O14936Q6H8Q1Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP | |||
| CASKLIN7BLIN7CPATJ | O14936Q8NI35Q9HAP6Q9NUP9 | 0:0:0:0 | hu.MAP |
Sequence, Structure & Domains10
Sequences
Length
197
Mass
21,834
Sequence
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT
3D Structural Models
Helix
7..26; 33..43; 45..60
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Motif
2..13; Kinase interacting site
Domain (CC)
The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.; DOMAIN: The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.; DOMAIN: The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes.
Domain (FT)
10..65; L27; 93..175; PDZ
Protein Families
Lin-7 family
Sequence Similarities
Belongs to the lin-7 family.
Clinical Relevance4
Antibody
Interaction Protein (5)
ENSG00000072415ENSG00000105926ENSG00000107282ENSG00000150054ENSG00000161647
Interaction Count
5
Interaction Dataset (2)
intact_biogrid_bioplexbiogrid_bioplex