Protein detail

LIN7C

Protein lin-7 homolog C (Lin-7C) (Mammalian lin-seven protein 3) (MALS-3) (Vertebrate lin-7 homolog 3) (Veli-3)

Entry name LIN7C	UniProt ID Q9NUP9	EVMP confidence score 0.38
Supporting publications (n)	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Protein lin-7 homolog C (Lin-7C) (Mammalian lin-seven protein 3) (MALS-3) (Vertebrate lin-7 homolog 3) (Veli-3)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000148943

Entrez Gene Symbol

LIN7C

Gene Synonym (5)

FLJ11215LIN-7-CLIN-7CMALS-3VELI3

Gene Description

Lin-7 homolog C, crumbs cell polarity complex component

Chromosome

Position

27494418-27506769

EVMP confidence score

0.38

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (10)

Molecular Function (5)

Reactome (9)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence28

Ligand-Receptor Signaling (19)

19 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
basolateral_cell_membrane	plasma_membrane	UniProt_location	No	No	Yes	No	No
basolateral_cell_membrane	plasma_membrane	Ramilowski_location	No	No	Yes	No	No
plasma_membrane	plasma_membrane	Ramilowski_location	No	No	Yes	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	Yes	No	No
secreted	secreted	connectomeDB2020	No	No	Yes	No	No
secreted	secreted	Cellinker	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
cell_surface	cell_surface	Baccin2019	No	No	Yes	No	No
cell_surface	cell_surface	OmniPath	No	No	Yes	No	No

Page 2 of 2Previous

Protein Complex Composition (8)

8 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
CASK-Mint1-Veli complex	APBA1 CASK LIN7C	O14936 Q02410 Q9NUP9	1:1:1	CORUMSIGNORCompleatComplexPortal	SIGNOR:SIGNOR-C561intact:EBI-42473580CORUM:617Compleat:HC917	15863617 10846156 14755292 9822620
	CASK LIN7B LIN7C MPDZ	O14936 O75970 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP
	APBA1 CASK LIN7B LIN7C	O14936 Q02410 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP
	CASK LIN7B LIN7C MPP3	O14936 Q13368 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP
	CASK LIN7B LIN7C MPP2	O14936 Q14168 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP
	CASK KIF26B LIN7B LIN7C	O14936 Q2KJY2 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP
	ABLIM2 CASK LIN7B LIN7C	O14936 Q6H8Q1 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP
	CASK LIN7B LIN7C PATJ	O14936 Q8NI35 Q9HAP6 Q9NUP9	0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	2	35119778 38716512

Sequence, Structure & Domains10

Sequences

Length

197

Mass

21,834

Sequence

MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT

3D Structural Models

Helix

7..26; 33..43; 45..60

3D Structure

X-ray crystallography (1)

Domain & Motif Annotations

Motif

2..13; Kinase interacting site

Domain (CC)

The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.; DOMAIN: The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.; DOMAIN: The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes.

Domain (FT)

10..65; L27; 93..175; PDZ

Protein Families

Lin-7 family

Sequence Similarities

Belongs to the lin-7 family.

Clinical Relevance4

Antibody

HPA051118

Interaction Protein (5)

ENSG00000072415ENSG00000105926ENSG00000107282ENSG00000150054ENSG00000161647

Interaction Count

Interaction Dataset (2)

intact_biogrid_bioplexbiogrid_bioplex