Protein detail

CC50A

Cell cycle control protein 50A (P4-ATPase flippase complex beta subunit TMEM30A) (Transmembrane protein 30A)

Protein symbol CC50A	UniProt ID Q9NV96	EVMP score 0.25
Frequency 2	Transmembrane count 2	Protein classification Predicted intracellular proteinsPredicted membrane proteinsTransporters

Basic Information

Protein Names

Cell cycle control protein 50A (P4-ATPase flippase complex beta subunit TMEM30A) (Transmembrane protein 30A)

Protein Class

Predicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function

Transporters:Transporter channels and pores
Predicted intracellular proteins
Transporters:Accessory Factors Involved in Transport

Transmembrane

50..70; Helical; 326..346; Helical

Transmembrane Count

Ensembl

ENSG00000112697

Entrez Gene Symbol

TMEM30A

Gene Synonym

C6orf67CDC50AFLJ10856

Gene Description

Transmembrane protein 30A

Chromosome

Position

75252924-75284948

Frequency

EVMP Score

0.25

Fluorescence & Localization

Cell SpecificEpididymal principal cellsBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted to bloodSecretome FunctionNo annotated function

Function & Pathway

Protein Function

Transporters:Transporter channels and pores
Predicted intracellular proteins
Transporters:Accessory Factors Involved in Transport

Cellular Component

Molecular Function

Biological Process

KEGG

hsa04148 Efferocytosis

Reactome

Mediation Categories

Clinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

20 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
tmem30_aminophospholipid_flippase	transporter	Almen2009	No	Yes	No	No	No
transporter	transporter	OmniPath	No	Yes	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No

Page 1 of 2Next

Regulatory Interaction Network

0 records.

Protein Complex Composition

12 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
ATP10A-CDC50A P4-ATPase complex	ATP10A TMEM30A	O60312 Q9NV96	1:1	ComplexPortal	intact:EBI-26444651	30509129 26567335 14755292 25947375 27458383 20961850 30530492
ATP10B-CDC50A P4-ATPase complex	ATP10B TMEM30A	O94823 Q9NV96	1:1	ComplexPortal	intact:EBI-26444684	30509129 26567335 32172343 14755292 25947375 27458383 20961850
ATP11A-CDC50A P4-ATPase complex	ATP11A TMEM30A	P98196 Q9NV96	1:1	ComplexPortal	intact:EBI-26445016	30509129 26567335 14755292 27458383 25315773 20961850
ATP11B-CDC50A P4-ATPase complex	ATP11B TMEM30A	Q9NV96 Q9Y2G3	1:1	ComplexPortal	intact:EBI-26445048	30509129 26567335 14755292 25947375 27458383 31571211 25315773 20961850
ATP11C-CDC50A P4-ATPase complex	ATP11C TMEM30A	Q8NB49 Q9NV96	4:4	ComplexPortalPDB	PDB:7bsqintact:EBI-26445086PDB:7vsgPDB:7bspPDB:7bsuPDB:6lknPDB:7bsvPDB:7bswPDB:7bssPDB:7vsh	30509129 21914794 26567335 14755292 27458383 25315773 20961850
ATP8A1-CDC50A P4-ATPase complex	ATP8A1 TMEM30A	Q9NV96 Q9Y2Q0	1:1	ComplexPortalPDB	PDB:6k7gPDB:6K7JPDB:6K7KPDB:6K7MPDB:6K7GPDB:6K7LPDB:6k7lPDB:6k7hintact:EBI-26442654PDB:6k7jPDB:6K7HPDB:6k7mPDB:6k7iPDB:6k7nPDB:6k7kPDB:6K7IPDB:6K7N	30509129 26567335 31416931 14755292 27458383 25315773 20961850
ATP8B3-CDC50A P4-ATPase complex	ATP8B3 TMEM30A	O60423 Q9NV96	1:1	ComplexPortal	intact:EBI-26443884	30509129 26567335 14755292 27458383 25315773 20961850
ATP8B4-CDC50A P4-ATPase complex	ATP8B4 TMEM30A	Q8TF62 Q9NV96	1:1	ComplexPortal	intact:EBI-26444020	30509129 26567335 14755292 27458383 25315773 20961850
	ARCN1 ARF4 ARFGEF2 BET1L COPA COPB1 COPB2 COPE COPG1 COPG2 COPZ1 GOSR2 SEC22B TMEM30A UBC	O14579 O14653 O75396 P0CG48 P18085 P35606 P48444 P53618 P53621 P61923 Q9NV96 Q9NYM9 Q9UBF2 Q9Y678 Q9Y6D5	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6641
	ARCN1 BET1L COPA COPB1 COPB2 COPE COPG1 COPG2 COPZ1 GOSR2 SCPEP1 SEC22B TMEM30A TRIM23 UBC	O14579 O14653 O75396 P0CG48 P35606 P36406 P48444 P53618 P53621 P61923 Q9HB40 Q9NV96 Q9NYM9 Q9UBF2 Q9Y678	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4058

Page 1 of 2Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	27605433

Sequence, Structure & Domains

Sequences

Length

361

Mass

40,684

Sequence

MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NV96-1; Sequence=Displayed; Name=2; IsoId=Q9NV96-2; Sequence=VSP_019568; Name=3; IsoId=Q9NV96-3; Sequence=VSP_019567

Alternative Sequence

1..119; Missing (in isoform 3); 79..114; Missing (in isoform 2)

3D Structural Models

Turn

32..36; 47..49; 227..229; 302..305

Helix

50..74; 92..95; 132..136; 140..143; 147..151; 155..160; 173..176; 207..211; 223..226; 247..249; 251..253; 255..261; 323..349

Beta Strand

78..81; 86..89; 98..100; 106..112; 118..126; 161..168; 182..188; 190..192; 194..196; 202..205; 213..215; 218..221; 240..243; 264..276; 280..283; 288..297; 307..314; 317..320

3D Structure

Electron microscopy (28); X-ray crystallography (1)

Domain & Motif Annotations

Domain (CC)

The N-terminal domain seems to play a role in the reaction cycle of the catalytic subunit such as ATP8A2..

Region

1..29; Disordered

Protein Families

CDC50/LEM3 family

Sequence Similarities

Belongs to the CDC50/LEM3 family.

Clinical Relevance

Antibody

HPA014561

Interaction Protein

ENSG00000068650ENSG00000101974ENSG00000124406ENSG00000127022ENSG00000142192

Interaction Count

Interaction Dataset

intact_biogridbiogrid_opencell