Protein detail
CC50A
Cell cycle control protein 50A (P4-ATPase flippase complex beta subunit TMEM30A) (Transmembrane protein 30A)
Entry name CC50A | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 2 | Transmembrane count 2 | Protein classification Predicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Cell cycle control protein 50A (P4-ATPase flippase complex beta subunit TMEM30A) (Transmembrane protein 30A)
Protein Class (3)
Predicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (3)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
Transmembrane
50..70; Helical; 326..346; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
C6orf67CDC50AFLJ10856
Gene Description
Transmembrane protein 30A
Chromosome
6
Position
75252924-75284948
Supporting publications (n)
2
EVMP confidence score
0.25
Fluorescence & Localization5
Cell SpecificEpididymal principal cellsBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted to bloodSecretome FunctionNo annotated function
Function & Pathway7
Protein Function (3)
- Transporters:Transporter channels and pores
- Predicted intracellular proteins
- Transporters:Accessory Factors Involved in Transport
Cellular Component (11)
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0030658 transport vesicle membrane
- GO:0031901 early endosome membrane
- GO:0031902 late endosome membrane
- GO:0035577 azurophil granule membrane
- GO:0035579 specific granule membrane
Page 1 of 2
Molecular Function (3)
Biological Process (3)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence33
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| tmem30_aminophospholipid_flippase | transporter | Almen2009 | No | Yes | No | No | No |
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
Page 1 of 2Next
Protein Complex Composition (12)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains13
Sequences
Length
361
Mass
40,684
Sequence
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NV96-1; Sequence=Displayed; Name=2; IsoId=Q9NV96-2; Sequence=VSP_019568; Name=3; IsoId=Q9NV96-3; Sequence=VSP_019567
Alternative Sequence
1..119; Missing (in isoform 3); 79..114; Missing (in isoform 2)
3D Structural Models
Turn
32..36; 47..49; 227..229; 302..305
Helix
50..74; 92..95; 132..136; 140..143; 147..151; 155..160; 173..176; 207..211; 223..226; 247..249; 251..253; 255..261; 323..349
Beta Strand
78..81; 86..89; 98..100; 106..112; 118..126; 161..168; 182..188; 190..192; 194..196; 202..205; 213..215; 218..221; 240..243; 264..276; 280..283; 288..297; 307..314; 317..320
3D Structure
Electron microscopy (28); X-ray crystallography (1)
Domain & Motif Annotations
Domain (CC)
The N-terminal domain seems to play a role in the reaction cycle of the catalytic subunit such as ATP8A2..
Region
1..29; Disordered
Protein Families
CDC50/LEM3 family
Sequence Similarities
Belongs to the CDC50/LEM3 family.
Clinical Relevance4
Antibody
Interaction Protein (5)
ENSG00000068650ENSG00000101974ENSG00000124406ENSG00000127022ENSG00000142192
Interaction Count
5
Interaction Dataset (2)
intact_biogridbiogrid_opencell
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |