Protein detail
KLRF1
Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C)
Entry name KLRF1 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C)
Transmembrane
39..59; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificKupffer cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (2)
Mediation Categories
Immune mediation
Relations & Evidence50
Ligand-Receptor Signaling (48)
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | connectomeDB2020 | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | connectomeDB2020 | Yes | Yes |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
231
Mass
26,563
Sequence
MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9NZS2-1; Sequence=Displayed; Name=2; Synonyms=KLRF1-s1; IsoId=Q9NZS2-2; Sequence=VSP_010391; Name=3; Synonyms=KLRF1-s3; IsoId=Q9NZS2-3; Sequence=VSP_010390, VSP_010392; Name=4; Synonyms=KLRF1-s2; IsoId=Q9NZS2-4; Sequence=VSP_010393, VSP_010394
Alternative Sequence
62..78; VSQGVLLKCQKGSCSNA -> GFYTEKPKTIKLRMDWA (in isoform 4); 62..64; VSQ -> DSS (in isoform 3); 63..112; Missing (in isoform 2); 65..231; Missing (in isoform 3); 79..231; Missing (in isoform 4)
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
121..230; C-type lectin
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |