Protein detail
KLRF1
Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C)
Entry name KLRF1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information7
Protein Names
Killer cell lectin-like receptor subfamily F member 1 (Lectin-like receptor F1) (Activating coreceptor NKp80) (C-type lectin domain family 5 member C)
Transmembrane
39..59; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization3
Cell SpecificKupffer cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway5
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (2)
Mediation Categories
Immune mediation
Relations & Evidence50
Ligand-Receptor Signaling (48)
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
Protein Complex Composition (1)
Sequence, Structure & Domains7
Sequences
Length
231
Mass
26,563
Sequence
MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGILTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9NZS2-1; Sequence=Displayed; Name=2; Synonyms=KLRF1-s1; IsoId=Q9NZS2-2; Sequence=VSP_010391; Name=3; Synonyms=KLRF1-s3; IsoId=Q9NZS2-3; Sequence=VSP_010390, VSP_010392; Name=4; Synonyms=KLRF1-s2; IsoId=Q9NZS2-4; Sequence=VSP_010393, VSP_010394
Alternative Sequence
62..78; VSQGVLLKCQKGSCSNA -> GFYTEKPKTIKLRMDWA (in isoform 4); 62..64; VSQ -> DSS (in isoform 3); 63..112; Missing (in isoform 2); 65..231; Missing (in isoform 3); 79..231; Missing (in isoform 4)
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
121..230; C-type lectin
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |