Protein detail
NTRI
Neurotrimin (hNT) (IgLON family member 2)
Entry name NTRI | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Neurotrimin (hNT) (IgLON family member 2)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CEPU-1HNTIGLON2NTRI
Gene Description
Neurotrimin
Chromosome
11
Position
131370478-132336822
Supporting publications (n)
6
EVMP confidence score
0.38
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence35
Ligand-Receptor Signaling (23)
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | Yes |
| ecm | ecm | OmniPath | Yes | No | No | No | Yes |
| extracellular | extracellular | OmniPath | No | No | No | No | Yes |
| intracellular | intracellular | LOCATE | No | No | No | No | Yes |
| intracellular | intracellular | ComPPI | No | No | No | No | Yes |
| intracellular | intracellular | OmniPath | No | No | No | No | Yes |
| iglon | cell_adhesion | HGNC | Yes | Yes | No | No | Yes |
| adhesion | adhesion | HGNC | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | Zhong2015 | Yes | Yes | No | No | Yes |
Page 1 of 3Next
Protein Complex Composition (11)
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CENPBNTMT2 | P07199Q5VVY1 | 2:2 | PDB | PDB:6kdr | ||
| DRG1ETF1LRRC41NTMT1POLA1ZC3H15 | P09884P62495Q15345Q8WU90Q9BV86Q9Y295 | 0:0:0:0:0:0 | hu.MAP2 | |||
| NTMT2RCC1 | P18754Q5VVY1 | 2:2 | PDB | PDB:6dub | ||
| NTMT1RCC1 | P18754Q9BV86 | 2:2 | PDB | PDB:5e2bPDB:5e1oPDB:5e2aPDB:5e1dPDB:5e1bPDB:5e1m | ||
| CENPANTMT2 | P49450Q5VVY1 | 1:1 | PDB | PDB:6kds | ||
| CENPANTMT1 | P49450Q9BV86 | 2:2 | PDB | PDB:5cvdPDB:6kdq | ||
| NTMT1TIRAP | P58753Q9BV86 | 0:0 | hu.MAP | |||
| DRG1GNL3LLRRC41NTMT1 | Q15345Q9BV86Q9NVN8Q9Y295 | 0:0:0:0 | hu.MAP | |||
| DRG1LRRC41NTMT1 | Q15345Q9BV86Q9Y295 | 0:0:0 | hu.MAP | |||
| NTMT1 | Q9BV86 | 2 | PDB | PDB:2ex4PDB:6wh8PDB:7k3dPDB:7u1mPDB:7ss1 |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation;Acoustic trapping | Mass spectrometry | 1 | 27487081 |
Sequence, Structure & Domains11
Sequences
Length
344
Mass
37,971
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9P121-1; Sequence=Displayed; Name=2; IsoId=Q9P121-2; Sequence=VSP_010939; Name=3; IsoId=Q9P121-3; Sequence=VSP_010940, VSP_010941; Name=4; IsoId=Q9P121-4; Sequence=VSP_041165
Alternative Sequence
1..27; MGVCGYLFLPWKCLVVVSLRLLFLVPT -> MKTIQPKMHNSISWAIFTGLAALCLFQ (in isoform 2); 311; F -> FEVKTTALTPWK (in isoform 4); 313..316; PGAV -> ETVL (in isoform 3); 317..344; Missing (in isoform 3)
3D Structural Models
Helix
107..109; 193..195
Beta Strand
45..48; 53..55; 66..70; 73..77; 88..92; 99..102; 111..117; 125..141; 145..148; 153..155; 157..163; 166..171; 184..190; 197..204; 206..208; 211..225; 241..249; 252..256; 271..273; 275..280; 292..298; 303..309
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
39..126; Ig-like C2-type 1; 136..218; Ig-like C2-type 2; 222..309; Ig-like C2-type 3
Protein Families (2)
- Immunoglobulin superfamily
- IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.
Clinical Relevance1
Antibody
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 31196968 | Cancer Cell Derived Small Extracellular Vesicles Contribute to Recipient Cell Metastasis Through Promoting HGF/c-Met Pathway. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No abstract available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No abstract available |