Protein detail
NTRI
Neurotrimin (hNT) (IgLON family member 2)
Entry name NTRI | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Neurotrimin (hNT) (IgLON family member 2)
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CEPU-1HNTIGLON2NTRI
Gene Description
Neurotrimin
Chromosome
11
Position
131370478-132336822
Supporting publications (n)
6
EVMP confidence score
0.50
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence35
Ligand-Receptor Signaling (23)
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| icam | cell_adhesion | Zhong2015 | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | HGNC | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| peripheral | peripheral | UniProt_location | Yes | ||||
| peripheral | peripheral | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | Yes |
Protein Complex Composition (11)
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CENPBNTMT2 | P07199Q5VVY1 | 2:2 | PDB | PDB:6kdr | ||
| DRG1ETF1LRRC41NTMT1POLA1ZC3H15 | P09884P62495Q15345Q8WU90Q9BV86Q9Y295 | 0:0:0:0:0:0 | hu.MAP2 | |||
| NTMT2RCC1 | P18754Q5VVY1 | 2:2 | PDB | PDB:6dub | ||
| NTMT1RCC1 | P18754Q9BV86 | 2:2 | PDB | PDB:5e2bPDB:5e1oPDB:5e2aPDB:5e1dPDB:5e1bPDB:5e1m | ||
| CENPANTMT2 | P49450Q5VVY1 | 1:1 | PDB | PDB:6kds | ||
| CENPANTMT1 | P49450Q9BV86 | 2:2 | PDB | PDB:5cvdPDB:6kdq | ||
| NTMT1TIRAP | P58753Q9BV86 | 0:0 | hu.MAP | |||
| DRG1GNL3LLRRC41NTMT1 | Q15345Q9BV86Q9NVN8Q9Y295 | 0:0:0:0 | hu.MAP | |||
| DRG1LRRC41NTMT1 | Q15345Q9BV86Q9Y295 | 0:0:0 | hu.MAP | |||
| NTMT1 | Q9BV86 | 2 | PDB | PDB:2ex4PDB:6wh8PDB:7k3dPDB:7u1mPDB:7ss1 |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation;Acoustic trapping | Mass spectrometry | 1 | 27487081 |
Sequence, Structure & Domains
Sequences
Length
344
Mass
37,971
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9P121-1; Sequence=Displayed; Name=2; IsoId=Q9P121-2; Sequence=VSP_010939; Name=3; IsoId=Q9P121-3; Sequence=VSP_010940, VSP_010941; Name=4; IsoId=Q9P121-4; Sequence=VSP_041165
Alternative Sequence
1..27; MGVCGYLFLPWKCLVVVSLRLLFLVPT -> MKTIQPKMHNSISWAIFTGLAALCLFQ (in isoform 2); 311; F -> FEVKTTALTPWK (in isoform 4); 313..316; PGAV -> ETVL (in isoform 3); 317..344; Missing (in isoform 3)
3D Structural Models
Helix
107..109; 193..195
Beta Strand
45..48; 53..55; 66..70; 73..77; 88..92; 99..102; 111..117; 125..141; 145..148; 153..155; 157..163; 166..171; 184..190; 197..204; 206..208; 211..225; 241..249; 252..256; 271..273; 275..280; 292..298; 303..309
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
39..126; Ig-like C2-type 1; 136..218; Ig-like C2-type 2; 222..309; Ig-like C2-type 3
Protein Families (2)
- Immunoglobulin superfamily
- IgLON family
Sequence Similarities
Belongs to the immunoglobulin superfamily. IgLON family.
Clinical Relevance
Antibody
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 31196968 | Cancer Cell Derived Small Extracellular Vesicles Contribute to Recipient Cell Metastasis Through Promoting HGF/c-Met Pathway. | No related sentences available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |