Protein detail

NTRI

Neurotrimin (hNT) (IgLON family member 2)

Entry name NTRI	UniProt ID Q9P121	EVMP confidence score 0.38
Supporting publications (n) 6	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Neurotrimin (hNT) (IgLON family member 2)

Protein Class (3)

Plasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000182667

Entrez Gene Symbol

NTM

Gene Synonym (4)

CEPU-1HNTIGLON2NTRI

Gene Description

Neurotrimin

Chromosome

Position

131370478-132336822

Supporting publications (n)

EVMP confidence score

0.38

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Reactome (2)

Mediation Categories

Metabolism mediation

Relations & Evidence35

Ligand-Receptor Signaling (23)

23 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane_peripheral	plasma_membrane_peripheral	OmniPath	No	No	No	No	Yes
cell_surface	cell_surface	Surfaceome	No	No	No	No	Yes
cell_surface	cell_surface	OmniPath	No	No	No	No	Yes

Page 3 of 3Previous

Protein Complex Composition (11)

11 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CENPB NTMT2	P07199 Q5VVY1	2:2	PDB	PDB:6kdr
DRG1 ETF1 LRRC41 NTMT1 POLA1 ZC3H15	P09884 P62495 Q15345 Q8WU90 Q9BV86 Q9Y295	0:0:0:0:0:0	hu.MAP2
NTMT2 RCC1	P18754 Q5VVY1	2:2	PDB	PDB:6dub
NTMT1 RCC1	P18754 Q9BV86	2:2	PDB	PDB:5e2bPDB:5e1oPDB:5e2aPDB:5e1dPDB:5e1bPDB:5e1m
CENPA NTMT2	P49450 Q5VVY1	1:1	PDB	PDB:6kds
CENPA NTMT1	P49450 Q9BV86	2:2	PDB	PDB:5cvdPDB:6kdq
NTMT1 TIRAP	P58753 Q9BV86	0:0	hu.MAP
DRG1 GNL3L LRRC41 NTMT1	Q15345 Q9BV86 Q9NVN8 Q9Y295	0:0:0:0	hu.MAP
DRG1 LRRC41 NTMT1	Q15345 Q9BV86 Q9Y295	0:0:0	hu.MAP
NTMT1	Q9BV86	2	PDB	PDB:2ex4PDB:6wh8PDB:7k3dPDB:7u1mPDB:7ss1

Page 1 of 2Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation；Acoustic trapping	Mass spectrometry	1	27487081

Sequence, Structure & Domains11

Sequences

Length

344

Mass

37,971

Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9P121-1; Sequence=Displayed; Name=2; IsoId=Q9P121-2; Sequence=VSP_010939; Name=3; IsoId=Q9P121-3; Sequence=VSP_010940, VSP_010941; Name=4; IsoId=Q9P121-4; Sequence=VSP_041165

Alternative Sequence

1..27; MGVCGYLFLPWKCLVVVSLRLLFLVPT -> MKTIQPKMHNSISWAIFTGLAALCLFQ (in isoform 2); 311; F -> FEVKTTALTPWK (in isoform 4); 313..316; PGAV -> ETVL (in isoform 3); 317..344; Missing (in isoform 3)

3D Structural Models

Helix

107..109; 193..195

Beta Strand

45..48; 53..55; 66..70; 73..77; 88..92; 99..102; 111..117; 125..141; 145..148; 153..155; 157..163; 166..171; 184..190; 197..204; 206..208; 211..225; 241..249; 252..256; 271..273; 275..280; 292..298; 303..309

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Domain (FT)

39..126; Ig-like C2-type 1; 136..218; Ig-like C2-type 2; 222..309; Ig-like C2-type 3

Protein Families (2)

Immunoglobulin superfamily
IgLON family

Sequence Similarities

Belongs to the immunoglobulin superfamily. IgLON family.

Clinical Relevance1

Antibody

CAB024875

Supporting Publications6

PMID	Title	Abstract
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No abstract available
28986585	Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics.	No abstract available
31196968	Cancer Cell Derived Small Extracellular Vesicles Contribute to Recipient Cell Metastasis Through Promoting HGF/c-Met Pathway.	No abstract available
34817906	Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform.	No abstract available
35611462	Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients.	No abstract available
37786918	Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.	No abstract available