Protein detail
SEPT3
Neuronal-specific septin-3
Entry name SEPT3 | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 17 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Neuronal-specific septin-3
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
SEP3SEPT3
Gene Description
Septin 3
Chromosome
22
Position
41969443-41998221
Supporting publications (n)
17
EVMP confidence score
0.60
Fluorescence & Localization7
Tissue SpecificplacentaCell SpecificExtravillous trophoblastsSingle-Nuclei Brain Specificcerebellar inhibitoryBlood Cell SpecificMAIT T-cellBlood Lineage SpecificT-cellsSecretome LocationSecreted in female reproductive systemSecretome FunctionCell adhesion
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (6)
Biological Process (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence13
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SEPTIN3 | PRKG1 | Q13976 | S | 91 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORHPRD | HPRD:15107017SIGNOR:15107017 |
| SEPTIN3 | PRKG1 | Q13976 | S | 78 | phosphorylation | KEA | KEA:15107017 |
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KGP1 | Q13976 | SEPT3 | Q9UH03 | Yes | Yes | No | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | ProtMapper:15107017HPRD:15107017HPRD-phos:15107017SIGNOR:15107017KEA:15107017 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ANLNRNF40SEPTIN11SEPTIN14SEPTIN3SEPTIN6 | O75150Q14141Q6ZU15Q9NQW6Q9NVA2Q9UH03 | 0:0:0:0:0:0 | hu.MAP | |||
| SEPTIN3SEPTIN7 | Q16181Q9UH03 | 2:2 | PDB | PDB:6uqq | ||
| PCMTD2SEPTIN14SEPTIN3 | Q6ZU15Q9NV79Q9UH03 | 0:0:0 | hu.MAP | |||
| SEPTIN3 | Q9UH03 | 2 | PDB | PDB:3sopPDB:4z54 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Mass spectrometry | 1 | 38576002 |
Sequence, Structure & Domains14
Sequences
Length
358
Mass
40,704
Sequence
MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=A, SEP3A; IsoId=Q9UH03-1; Sequence=Displayed; Name=2; Synonyms=B, SEP3B; IsoId=Q9UH03-2; Sequence=VSP_006049; Name=3; Synonyms=C, SEP3C; IsoId=Q9UH03-3; Sequence=VSP_025398, VSP_025399
Alternative Sequence
68..83; GQSGLGKSTLVNTLFK -> AGSPLRSTSMSSTRSS (in isoform 3); 84..358; Missing (in isoform 3); 338..358; GEGLLGTVLPPVPATPCPTAE -> VSVDTEESHDSNP (in isoform 2)
3D Structural Models
Turn
127..130; 136..139; 197..199; 292..294; 306..308
Helix
45..52; 74..84; 92..94; 140..156; 187..196; 209..211; 214..230; 239..241; 245..256; 297..305; 309..318; 320..327
Beta Strand
59..69; 70..73; 106..114; 117..125; 132..134; 173..178; 182..184; 202..208; 260..262; 269..272; 275..281; 286..288
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
1..10; Basic and acidic residues
Domain (FT)
58..331; Septin-type G
Region
1..30; Disordered; 68..75; G1 motif; 125..128; G3 motif; 207..210; G4 motif
Protein Families (2)
- TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily
- Septin GTPase family
Sequence Similarities
Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. Septin GTPase family.
Clinical Relevance5
Interaction Protein (7)
ENSG00000122545ENSG00000125354ENSG00000138758ENSG00000164402ENSG00000168385ENSG00000180096ENSG00000184640
Interaction Count
7
Interaction Dataset (2)
biogrid_opencellintact_biogrid
Supporting Publications16
| PMID | Title | Abstract |
|---|---|---|
| 39478498 | Proteomic analysis of plasma total exosomes and placenta-derived exosomes in patients with gestational diabetes mellitus in the first and second trimesters. | No abstract available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No abstract available |
| 39989284 | Altered proteomics in brain extracellular vesicles from depressed individuals who died by suicide implicates synaptic processes. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No abstract available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No abstract available |
Page 2 of 2Previous