Protein detail
CAH14
Carbonic anhydrase 14 (EC 4.2.1.1) (Carbonate dehydratase XIV) (Carbonic anhydrase XIV) (CA-XIV)
Entry name CAH14 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Carbonic anhydrase 14 (EC 4.2.1.1) (Carbonate dehydratase XIV) (Carbonic anhydrase XIV) (CA-XIV)
Protein Class (5)
EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (4)
- Predicted intracellular proteins
- Enzymes
- FDA approved drug targets:Small molecule drugs
- ENZYME proteins:Lyases
Transmembrane
291..311; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
Carbonic anhydrase 14
Chromosome
1
Position
150257251-150265078
Supporting publications (n)
6
EVMP confidence score
0.63
Fluorescence & Localization
Cell SpecificAdipocytes
Function & Pathway
Protein Function (4)
- Predicted intracellular proteins
- Enzymes
- FDA approved drug targets:Small molecule drugs
- ENZYME proteins:Lyases
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence23
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | Yes | |||
| cell_surface_enzyme | cell_surface_enzyme | Surfaceome | Yes | Yes | |||
| cell_surface_enzyme | cell_surface_enzyme | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes |
Page 1 of 2Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blotting | 1 | 36064647 |
Sequence, Structure & Domains
Sequences
Length
337
Mass
37,668
Sequence
MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA
3D Structural Models
Turn
141..143
Helix
30..32; 33..36; 38..41; 52..54; 147..150; 172..178; 179..183; 198..201; 238..245
Beta Strand
24..26; 42..44; 66..68; 77..81; 86..89; 95..101; 103..112; 122..125; 131..140; 157..169; 190..193; 209..214; 225..232; 234..237; 249..255; 275..277
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
20..278; Alpha-carbonic anhydrase
Protein Families
Alpha-carbonic anhydrase family
Sequence Similarities
Belongs to the alpha-carbonic anhydrase family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs (8)
Antibody
Supporting Publications6
| PMID | Title | Related sentences |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No related sentences available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |
| 37563857 | Comprehensive characterization of human brain-derived extracellular vesicles using multiple isolation methods: Implications for diagnostic and therapeutic applications. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 40730843 | Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury. | No related sentences available |