Protein detail

TNF18

Tumor necrosis factor ligand superfamily member 18 (Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL)

Entry name TNF18	UniProt ID Q9UNG2	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Tumor necrosis factor ligand superfamily member 18 (Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL)

Protein Function

Predicted intracellular proteins

Transmembrane

28..48; Helical; Signal-anchor for type II membrane protein

Transmembrane Count

Ensembl

ENSG00000120337

Entrez Gene Symbol

TNFSF18

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (3)

Molecular Function (5)

Biological Process (3)

KEGG

hsa04060 Cytokine-cytokine receptor interaction

Reactome (3)

Mediation Categories (2)

Adhesion and uptake mediationImmune mediation

Relations & Evidence50

Ligand-Receptor Signaling (47)

47 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	HPMR	No	No	Yes	Yes	No
extracellular	extracellular	OmniPath	No	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	connectomeDB2020	Yes	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	Baccin2019	Yes	No	Yes	Yes	No
tumor_necrosis_factor	cell_surface_ligand	HGNC	Yes	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	Yes	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	Yes	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	Yes	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	Yes	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	Yes	Yes	No

Page 1 of 5Next

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	TNFSF18	Q9UNG2	3	PDB	PDB:3b94PDB:3b93
	TNFRSF18 TNFSF18	Q9UNG2 Q9Y5U5	2:2	PDB	PDB:7khdPDB:7law

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	7	37427430 39408670 40596376 38037300 39702169 39778061 40689422

Sequence, Structure & Domains10

Sequences

Length

177

Mass

20,308

Sequence

MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS

3D Structural Models

Turn

65..67

Helix

155..157; 160..162

Beta Strand

59..62; 69..72; 78..83; 86..89; 93..101; 109..111; 115..119; 122..127; 130..132; 138..142; 147..154; 164..171

3D Structure

X-ray crystallography (7)

Domain & Motif Annotations

Domain (FT)

47..170; THD

Protein Families

Tumor necrosis factor family

Sequence Similarities

Belongs to the tumor necrosis factor family.

Supporting Publications1

PMID	Title	Abstract
34265469	Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer.	Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes.