Protein detail
TNF18
Tumor necrosis factor ligand superfamily member 18 (Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL)
Entry name TNF18 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Tumor necrosis factor ligand superfamily member 18 (Activation-inducible TNF-related ligand) (AITRL) (Glucocorticoid-induced TNF-related ligand) (hGITRL)
Protein Function
Predicted intracellular proteins
Transmembrane
28..48; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (5)
Biological Process (3)
Reactome (3)
Mediation Categories (2)
Adhesion and uptake mediationImmune mediation
Relations & Evidence50
Ligand-Receptor Signaling (47)
47 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | Yes | No |
Protein Complex Composition (2)
Sequence, Structure & Domains10
Sequences
Length
177
Mass
20,308
Sequence
MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
3D Structural Models
Turn
65..67
Helix
155..157; 160..162
Beta Strand
59..62; 69..72; 78..83; 86..89; 93..101; 109..111; 115..119; 122..127; 130..132; 138..142; 147..154; 164..171
3D Structure
X-ray crystallography (7)
Domain & Motif Annotations
Domain (FT)
47..170; THD
Protein Families
Tumor necrosis factor family
Sequence Similarities
Belongs to the tumor necrosis factor family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |