Protein detail
ITM2B
Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]
Entry name ITM2B | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 16 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C-terminal peptide) (P23 peptide)]
Protein Class (7)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteinsTransporters
Protein Function (7)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Human disease related genes:Congenital malformations:Congenital malformations of eye
- Potential drug targets
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Transmembrane
55..75; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
BRIBRI2BRICD2BE25BE3-16
Gene Description
Integral membrane protein 2B
Chromosome
13
Position
48232612-48270357
Supporting publications (n)
16
EVMP confidence score
0.72
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificneutrophil
Function & Pathway
Protein Function (7)
- Predicted intracellular proteins
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Human disease related genes:Congenital malformations:Congenital malformations of eye
- Potential drug targets
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Cellular Component (11)
- GO:0000139 Golgi membrane
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0010008 endosome membrane
- GO:0016020 membrane
- GO:0030660 Golgi-associated vesicle membrane
- GO:0031090 organelle membrane
- GO:0043231 intracellular membrane-bounded organelle
Page 1 of 2
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence32
Ligand-Receptor Signaling (29)
29 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | Yes | |||
| secreted | secreted | UniProt_keyword | Yes | Yes | |||
| secreted | secreted | OmniPath | Yes | Yes | |||
| cell_surface | cell_surface | Surfaceome | Yes | Yes | |||
| cell_surface | cell_surface | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane_predicted | Phobius | Yes | Yes | |||
| transmembrane_phobius | transmembrane_predicted | Almen2009 | Yes | Yes | |||
| transmembrane_sosui | transmembrane_predicted | Almen2009 | Yes | Yes | |||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | Yes | Yes |
Page 3 of 3Previous
Protein Complex Composition (2)
Sequence, Structure & Domains
Sequences
Length
266
Mass
30,338
Sequence
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y287-1; Sequence=Displayed; Name=2; IsoId=Q9Y287-2; Sequence=VSP_055326
Alternative Sequence
83..188; Missing (in isoform 2)
3D Structural Models
Turn
123..126; 149..152; 159..162
Helix
180..185; 217..222
Beta Strand
118..122; 127..132; 136..139; 143..148; 153..156; 164..168; 227..230
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Domain (FT)
137..231; BRICHOS
Region
102..134; Necessary for interaction with APP and inhibitor effects on APP processing
Protein Families
ITM2 family
Sequence Similarities
Belongs to the ITM2 family.
Clinical Relevance
Disease Involvement (4)
AmyloidosisDeafnessDisease variantNeurodegeneration
Related Diseases (2)
Supporting Publications16
| PMID | Title | Related sentences |
|---|---|---|
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 38590132 | Proteomic Identification of Small Extracellular Vesicle Proteins LAMB1 and Histone H4 for Prostate Cancer Diagnosis and Risk Stratification. | Proteomic Identification of Small Extracellular Vesicle Proteins LAMB1 and Histone H4 for Prostate Cancer Diagnosis and Risk Stratification. |
| 39001700 | Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
Page 2 of 2Previous