Protein detail
VATD
V-type proton ATPase subunit D (V-ATPase subunit D) (V-ATPase 28 kDa accessory protein) (Vacuolar proton pump subunit D)
Entry name VATD | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Essential proteinsMetabolic proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
V-type proton ATPase subunit D (V-ATPase subunit D) (V-ATPase 28 kDa accessory protein) (Vacuolar proton pump subunit D)
Protein Class (3)
Essential proteinsMetabolic proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ATP6MVATDVMA8
Gene Description
ATPase H+ transporting V1 subunit D
Chromosome
14
Position
67294371-67360265
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Tissue Specificbrain
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (15)
- GO:0000139 Golgi membrane
- GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain
- GO:0005654 nucleoplasm
- GO:0005765 lysosomal membrane
- GO:0005813 centrosome
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005929 cilium
- GO:0010008 endosome membrane
- GO:0016020 membrane
Page 1 of 2
Molecular Function (2)
Biological Process (3)
KEGG (11)
- hsa00190 Oxidative phosphorylation
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04142 Lysosome biogenesis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04150 mTOR signaling pathway
- KEGG:hsa04721 Synaptic vesicle cycle
- KEGG:hsa04966 Collecting duct acid secretion
- KEGG:hsa05110 Vibrio cholerae infection
- KEGG:hsa05120 Epithelial cell signaling in Helicobacter pylori infection
- KEGG:hsa05165 Human papillomavirus infection
Page 1 of 2
Reactome (16)
- R-hsa-9639288 amino acids regulate mtorc1
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711097 cellular response to starvation
- R-hsa-168249 innate immune system
- R-hsa-77387 insulin receptor recycling
- R-hsa-983712 ion channel transport
- R-hsa-917937 iron uptake and transport
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-6798695 neutrophil degranulation
Page 1 of 2
Mediation Categories (3)
Fusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence20
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Protein Complex Composition (13)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30915084 |
Sequence, Structure & Domains8
Sequences
Length
247
Mass
28,263
Sequence
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE
3D Structural Models
Helix
15..73; 80..85; 129..174; 176..215
Beta Strand
94..101; 104..110; 118..126
3D Structure
Electron microscopy (8)
Domain & Motif Annotations
Protein Families
V-ATPase D subunit family
Sequence Similarities
Belongs to the V-ATPase D subunit family.
Clinical Relevance4
Interaction Protein (14)
ENSG00000033627ENSG00000047249ENSG00000110719ENSG00000114573ENSG00000116039ENSG00000128524ENSG00000131100ENSG00000136888ENSG00000147416ENSG00000155097ENSG00000159720ENSG00000171159ENSG00000182220ENSG00000250565
Interaction Count
14
Interaction Dataset (5)
biogrid_opencellbiogrid_bioplexbiogrid_opencell_bioplexintact_biogrid_opencell_bioplexintact_biogrid_bioplex
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |