Protein detail

NPFF2

Neuropeptide FF receptor 2 (G-protein coupled receptor 74) (G-protein coupled receptor HLWAR77) (Neuropeptide G-protein coupled receptor)

Entry name NPFF2	UniProt ID Q9Y5X5	EVMP score 0.50
Frequency 1	Transmembrane count 7	Protein classification

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Neuropeptide FF receptor 2 (G-protein coupled receptor 74) (G-protein coupled receptor HLWAR77) (Neuropeptide G-protein coupled receptor)

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

148..168; Helical; Name=1; 185..205; Helical; Name=2; 222..242; Helical; Name=3; 263..283; Helical; Name=4; 320..340; Helical; Name=5; 378..398; Helical; Name=6; 414..434; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000056291

Entrez Gene Symbol

NPFFR2

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificBreast lactating cells

Function & Pathway

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component

Molecular Function

KEGG

hsa04080 Neuroactive ligand-receptor interaction

Reactome

Mediation Categories

Receptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
NPFFR2	GRK2	P25098	S	520	phosphorylation	PhosphoSite
NPFFR2	GRK2	P25098	T	517	phosphorylation	PhosphoSite
NPFFR2	GRK2	P25098	S	519	phosphorylation	PhosphoSite
NPFFR2	GRK2	P25098	T	516	phosphorylation	PhosphoSite

Ligand-Receptor Signaling

52 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
class_a_rhodopsin_peptide_neuropeptide_ff_neuropeptide_af	receptor	GPCRdb	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No

Page 3 of 6Previous Next

Regulatory Interaction Network

6 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
NPFF	O15130	NPFF2	Q9Y5X5	Yes	Yes	No	iTALKGuide2Pharma_LRdbSIGNORHPMR_talklrHPMRCellChatDBHPRD_LRdbtalklrscConnectHPRDRamilowski2015_Baccin2019Guide2Pharma_CellinkerWangRamilowski2015HPMR_LRdbCellPhoneDBGuide2Pharma_talklrHPRD_talklrBaccin2019CellinkerSTRING_talklrGuide2PharmaCellTalkDBFantom5_LRdbHPMR_CellinkerconnectomeDB2020LRdb	connectomeDB2020:10851242 connectomeDB2020:11325787 LRdb:12609745 Cellinker:10851242 scConnect:11325787 HPRD:10851242 CellTalkDB:11024015 HPMR:11024015 Cellinker:11024015 Baccin2019:12609745 Cellinker:12421602 Guide2Pharma:11325787 Baccin2019:11024015 Cellinker:11325787 Baccin2019:12421602 connectomeDB2020:12609745 Cellinker:12609745 LRdb:10851242 Baccin2019:11325787 LRdb:11325787 LRdb:11024015 Baccin2019:10851242 scConnect:12421602 HPRD:12609745 connectomeDB2020:12421602 LRdb:12421602 Guide2Pharma:12421602 SIGNOR:11024015 connectomeDB2020:11024015
NPFF2	Q9Y5X5	GNAI3	P08754	Yes	Yes	No	SIGNOR	SIGNOR:31160049
NPFF2	Q9Y5X5	GNAO	P09471	Yes	Yes	No	SIGNOR	SIGNOR:31160049
NPFF2	Q9Y5X5	GNAI1	P63096	Yes	Yes	No	SIGNOR	SIGNOR:31160049
NPFF2	Q9Y5X5	GNAZ	P19086	Yes	Yes	No	SIGNOR	SIGNOR:31160049
ARBK1	P25098	NPFF2	Q9Y5X5	Yes	No	No	PhosphoSite_norefPhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:25326382

Protein Complex Composition

0 records.

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	ELISA	1	37322475

Sequence, Structure & Domains

Sequences

Length

522

Mass

60,270

Sequence

MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI

Alternative Products

Event=Alternative splicing; Named isoforms=4; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; Synonyms=long form; IsoId=Q9Y5X5-1; Sequence=Displayed; Name=2; Synonyms=short form; IsoId=Q9Y5X5-2; Sequence=VSP_001907; Name=3; IsoId=Q9Y5X5-3; Sequence=VSP_001908, VSP_001909; Name=4; IsoId=Q9Y5X5-4; Sequence=VSP_001910, VSP_001911

Alternative Sequence

1..102; Missing (in isoform 2); 1..99; Missing (in isoform 3); 100; R -> M (in isoform 3); 101..132; FIMNEKWDTNSSENWHPIWNVNDTKHHLYSDI -> MAIWKHDVQDQWIGPGNICRSFSLYVSCNCCR (in isoform 4); 133..522; Missing (in isoform 4)

3D Structural Models

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Region

25..49; Disordered

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance

Drugs

KISSPEPTIN-10