Protein detail
NPFF2
Neuropeptide FF receptor 2 (G-protein coupled receptor 74) (G-protein coupled receptor HLWAR77) (Neuropeptide G-protein coupled receptor)
Entry name NPFF2 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 7 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Neuropeptide FF receptor 2 (G-protein coupled receptor 74) (G-protein coupled receptor HLWAR77) (Neuropeptide G-protein coupled receptor)
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Transmembrane
148..168; Helical; Name=1; 185..205; Helical; Name=2; 222..242; Helical; Name=3; 263..283; Helical; Name=4; 320..340; Helical; Name=5; 378..398; Helical; Name=6; 414..434; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificBreast lactating cells
Function & Pathway
Protein Function
G-protein coupled receptors:GPCRs excl olfactory receptors
Cellular Component
Molecular Function
Reactome
Mediation Categories
Receptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
Ligand-Receptor Signaling
52 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | GO_Intercell | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network
6 records.
Protein Complex Composition
0 records.
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | ELISA | 1 | 37322475 |
Sequence, Structure & Domains
Sequences
Length
522
Mass
60,270
Sequence
MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
Alternative Products
Event=Alternative splicing; Named isoforms=4; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; Synonyms=long form; IsoId=Q9Y5X5-1; Sequence=Displayed; Name=2; Synonyms=short form; IsoId=Q9Y5X5-2; Sequence=VSP_001907; Name=3; IsoId=Q9Y5X5-3; Sequence=VSP_001908, VSP_001909; Name=4; IsoId=Q9Y5X5-4; Sequence=VSP_001910, VSP_001911
Alternative Sequence
1..102; Missing (in isoform 2); 1..99; Missing (in isoform 3); 100; R -> M (in isoform 3); 101..132; FIMNEKWDTNSSENWHPIWNVNDTKHHLYSDI -> MAIWKHDVQDQWIGPGNICRSFSLYVSCNCCR (in isoform 4); 133..522; Missing (in isoform 4)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Region
25..49; Disordered
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Clinical Relevance
Drugs