Protein detail
KCNE3
Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)
Entry name KCNE3 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)
Protein Class (6)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Transmembrane
57..77; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
HOKPPMiRP2
Gene Description
Potassium voltage-gated channel subfamily E regulatory subunit 3
Chromosome
11
Position
74454841-74467729
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Cellular Component (9)
Molecular Function (5)
Biological Process (3)
Reactome (4)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence33
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| KCNE3 | PRKCA | P17252 | S | 82 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| auxiliary_transport_unit | transporter | Almen2009 | Yes | Yes | |||
| ion_channel | ion_channel | DGIdb | Yes | Yes | |||
| voltage_gated_potassium | ion_channel | HGNC | Yes | Yes | |||
| ion_channel | ion_channel | HGNC | Yes | Yes | |||
| voltage_gated_potassium | ion_channel | Almen2009 | Yes | Yes |
Page 1 of 3Next
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCD | Q05655 | KCNE3 | Q9Y6H6 | Yes | Yes | SIGNOR | SIGNOR:21911611 | |
| KCNE3 | Q9Y6H6 | KCNQ1 | P51787 | Yes | Yes | HINTSIGNOR | HINT:31883792SIGNOR:21911611 | |
| KPCA | P17252 | KCNE3 | Q9Y6H6 | Yes | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:16449802PhosphoSite:21911611 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
103
Mass
11,710
Sequence
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
3D Structural Models
Helix
8..29; 57..80; 91..98
3D Structure
Electron microscopy (3); NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
43..53; Basic and acidic residues
Region
32..53; Disordered; 68..79; Interaction with KCNQ1
Protein Families
Potassium channel KCNE family
Sequence Similarities
Belongs to the potassium channel KCNE family.
Clinical Relevance
Disease Involvement (2)
Brugada syndromeDisease variant
Related Diseases
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 12519789 | Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation. | An alpha 4-integrin may direct B cell-derived exosomes to follicular dendritic cells, which were described previously as potential target cells. Most exosome-associated proteins, including MHC class II and tetraspanins, were insoluble in 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonic acid (CHAPS)-containing buffers. |