Protein detail

KCNE3

Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)

Entry name KCNE3	UniProt ID Q9Y6H6	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 1	Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)

Protein Class (6)

Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (5)

Predicted intracellular proteins
Potential drug targets
Transporters:Accessory Factors Involved in Transport
Disease related genes
Human disease related genes:Cardiovascular diseases:Cardiac diseases

Transmembrane

57..77; Helical

Transmembrane Count

Ensembl

ENSG00000175538

Entrez Gene Symbol

KCNE3

Gene Synonym (2)

HOKPPMiRP2

Gene Description

Potassium voltage-gated channel subfamily E regulatory subunit 3

Chromosome

Position

74454841-74467729

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Function & Pathway7

Protein Function (5)

Predicted intracellular proteins
Potential drug targets
Transporters:Accessory Factors Involved in Transport
Disease related genes
Human disease related genes:Cardiovascular diseases:Cardiac diseases

Cellular Component (9)

Molecular Function (5)

Biological Process (3)

KEGG

hsa04974 Protein digestion and absorption

Reactome (4)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence33

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
KCNE3	PRKCA	P17252	S	82	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (28)

28 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	UniProt_location	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
auxiliary_transport_unit	transporter	Almen2009	No	Yes	No	Yes	No
ion_channel	ion_channel	DGIdb	No	Yes	No	Yes	No
voltage_gated_potassium	ion_channel	HGNC	No	Yes	No	Yes	No
ion_channel	ion_channel	HGNC	No	Yes	No	Yes	No
voltage_gated_potassium	ion_channel	Almen2009	No	Yes	No	Yes	No

Page 1 of 3Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCD	Q05655	KCNE3	Q9Y6H6	Yes	Yes	No	SIGNOR	SIGNOR:21911611
KCNE3	Q9Y6H6	KCNQ1	P51787	Yes	Yes	No	HINTSIGNOR	HINT:31883792 SIGNOR:21911611
KPCA	P17252	KCNE3	Q9Y6H6	Yes	No	No	PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:16449802 PhosphoSite:21911611

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry	0

Sequence, Structure & Domains9

Sequences

Length

103

Mass

11,710

Sequence

METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI

3D Structural Models

Helix

8..29; 57..80; 91..98

3D Structure

Electron microscopy (3); NMR spectroscopy (1)

Domain & Motif Annotations

Compositional Bias

43..53; Basic and acidic residues

Region

32..53; Disordered; 68..79; Interaction with KCNQ1

Protein Families

Potassium channel KCNE family

Sequence Similarities

Belongs to the potassium channel KCNE family.

Clinical Relevance2

Disease Involvement (2)

Brugada syndromeDisease variant

Antibody

HPA014849

Supporting Publications1

PMID	Title	Abstract
12519789	Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation.	An alpha 4-integrin may direct B cell-derived exosomes to follicular dendritic cells, which were described previously as potential target cells. Most exosome-associated proteins, including MHC class II and tetraspanins, were insoluble in 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonic acid (CHAPS)-containing buffers.