Protein detail
KCNE3
Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)
Entry name KCNE3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)
Protein Class (6)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Transmembrane
57..77; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
HOKPPMiRP2
Gene Description
Potassium voltage-gated channel subfamily E regulatory subunit 3
Chromosome
11
Position
74454841-74467729
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway7
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
Cellular Component (9)
Molecular Function (5)
Biological Process (3)
Reactome (4)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence33
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| KCNE3 | PRKCA | P17252 | S | 82 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (28)
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transporter | transporter | OmniPath | No | Yes | No | Yes | No |
| ion_channel | ion_channel | OmniPath | No | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCD | Q05655 | KCNE3 | Q9Y6H6 | Yes | Yes | No | SIGNOR | SIGNOR:21911611 |
| KCNE3 | Q9Y6H6 | KCNQ1 | P51787 | Yes | Yes | No | HINTSIGNOR | HINT:31883792SIGNOR:21911611 |
| KPCA | P17252 | KCNE3 | Q9Y6H6 | Yes | No | No | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:16449802PhosphoSite:21911611 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains9
Sequences
Length
103
Mass
11,710
Sequence
METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI
3D Structural Models
Helix
8..29; 57..80; 91..98
3D Structure
Electron microscopy (3); NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
43..53; Basic and acidic residues
Region
32..53; Disordered; 68..79; Interaction with KCNQ1
Protein Families
Potassium channel KCNE family
Sequence Similarities
Belongs to the potassium channel KCNE family.
Clinical Relevance2
Disease Involvement (2)
Brugada syndromeDisease variant
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 12519789 | Proteomic and biochemical analyses of human B cell-derived exosomes. Potential implications for their function and multivesicular body formation. | An alpha 4-integrin may direct B cell-derived exosomes to follicular dendritic cells, which were described previously as potential target cells. Most exosome-associated proteins, including MHC class II and tetraspanins, were insoluble in 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonic acid (CHAPS)-containing buffers. |