Protein detail

EPN1

Epsin-1 (EH domain-binding mitotic phosphoprotein) (EPS-15-interacting protein 1)

Entry name EPN1	UniProt ID Q9Y6I3	EVMP confidence score 0.63
Supporting publications (n) 9	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

Basic Information

Protein Names

Epsin-1 (EH domain-binding mitotic phosphoprotein) (EPS-15-interacting protein 1)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000063245

Entrez Gene Symbol

EPN1

Gene Description

Epsin 1

Chromosome

Position

55675226-55709858

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization

Tissue Specificheart muscleCell SpecificDecidual stromal cellsSingle-Nuclei Brain Specificoligodendrocyte

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component (6)

Molecular Function (4)

KEGG

hsa04144 Endocytosis

Reactome (7)

Mediation Categories (2)

Fusion and delivery mediationReceptor-signaling mediation

Relations & Evidence26

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
EPN1	CDK1	P06493	S	357	phosphorylation	phosphoELMKEA	KEA:17570479 phosphoELM:10764745 KEA:10764745
EPN1	CDK1	P06493	S	468	phosphorylation	MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP
EPN1	GSK3B	P49841	S	357	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (11)

11 records.

Category	Parent	Database	Transmitter	Receiver
intracellular	intracellular	LOCATE
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	UniProt_location
intracellular	intracellular	OmniPath
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes
adhesion	adhesion	OmniPath	Yes	Yes
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes
plasma_membrane	plasma_membrane	UniProt_location
plasma_membrane	plasma_membrane	Cellinker

Page 1 of 2Next

Regulatory Interaction Network (4)

4 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
EPN1	Q9Y6I3	EGFR	P00533	Yes		Yes	WangSIGNORBioGRID	BioGRID:19054389 SIGNOR:19054389
EPN1	Q9Y6I3		COMPLEX:CHEBI:18348_O94973_P09496_P09497_P53675_P53680_P63010_Q00610_Q96CW1	Yes	Yes		SIGNOR	SIGNOR:24789820
	COMPLEX:O94973_P53680_P63010_Q96CW1	EPN1	Q9Y6I3	Yes	Yes		SIGNOR	SIGNOR:15496985
CDK1	P06493	EPN1	Q9Y6I3	Yes	Yes	Yes	HPRD_MIMPSIGNORProtMapperdbPTMPhosphoSite_KEAphosphoELM_KEAHPRDWangPhosphoSite_ProtMapperNetworKIN_KEAphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite	phosphoELM:10764745 HPRD:10764745 PhosphoSite:10764745 KEA:10764745 SIGNOR:10764745 KEA:17570479 ProtMapper:10764745 dbPTM:10764745

Protein Complex Composition (7)

7 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ARHGAP31 CDC42 CDK1 DIAPH2 EPN1 PAK6 PLEKHG2 TBC1D3F	A6NER0 O60879 P06493 P60953 Q2M1Z3 Q9H7P9 Q9NQU5 Q9Y6I3	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3724
AP1B1 AP1G1 AP1M1 AP1M2 AP1S1 AP1S2 AP2B1 ASMTL CLINT1 CLTB CLTC EPN1 GGA2 UBC	O43747 O95671 P09497 P0CG48 P56377 P61966 P63010 Q00610 Q10567 Q14677 Q9BXS5 Q9UJY4 Q9Y6I3 Q9Y6Q5	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4458
EPN1 EPN2 EPN3	O95208 Q9H201 Q9Y6I3	0:0:0	hu.MAP2
CCDC25 EPN1 NDRG2 TYMS	P04818 Q86WR0 Q9UN36 Q9Y6I3	0:0:0:0	hu.MAP2
EPN1 NDRG2 TYMS	P04818 Q9UN36 Q9Y6I3	0:0:0	hu.MAP2
EPN1 UROD	P06132 Q9Y6I3	0:0	hu.MAP
CCNB1 EPN1	P14635 Q9Y6I3	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	11	36064647 40189497 38895962 41068253 33592500 30915084 33309826 37670049 37223008 36982312 37438638

Sequence, Structure & Domains

Sequences

Length

576

Mass

60,293

Sequence

MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIRRGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9Y6I3-2; Sequence=Displayed; Name=2; IsoId=Q9Y6I3-1; Sequence=VSP_041010, VSP_041011; Name=3; IsoId=Q9Y6I3-3; Sequence=VSP_041011, VSP_041012

Alternative Sequence

1; M -> MGDQSWLWNQAAPGVRSPVFACSVEKGNVPLVLSEHLAHSRDPGSGAVRFLISPEPWASAILGTSGLLASPVLPAALDAVTCQHLPQPSSGSRPISPRIGALCPLLLQPGTM (in isoform 2); 202..226; Missing (in isoform 2 and isoform 3); 393; Missing (in isoform 3)

3D Structural Models

Helix

20..27; 39..47; 51..62; 63..65; 72..86; 90..98; 100..108; 121..134

3D Structure

NMR spectroscopy (1); X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

157..167; Low complexity; 265..296; Low complexity; 297..314; Pro residues; 332..368; Low complexity; 454..468; Pro residues; 557..570; Pro residues

Repeat

274..276; 1; 294..296; 2; 306..308; 3; 319..321; 4; 332..334; 5; 349..351; 6; 367..369; 7; 377..379; 8; 502..504; 1; 518..520; 2; 572..574; 3

Motif

402..411; [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif

Domain (CC)

The NPF repeat domain is involved in EPS15 binding.; DOMAIN: The DPW repeat domain is involved in AP2A2 and clathrin binding.; DOMAIN: The [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif mediates interaction with the AP-2 complex subunit AP2B1..

Domain (FT)

12..144; ENTH; 183..202; UIM 1; 208..227; UIM 2; 233..252; UIM 3

Region

149..185; Disordered; 265..404; Disordered; 274..379; 8 X 3 AA repeats of [ED]-P-W; 448..576; Disordered; 502..574; 3 X 3 AA repeats of N-P-F

Protein Families

Epsin family

Sequence Similarities

Belongs to the epsin family.

Clinical Relevance

Antibody (3)

CAB009729 HPA061136 HPA071503

Interaction Protein (3)

ENSG00000085832ENSG00000092621ENSG00000169891

Interaction Count

Interaction Dataset (2)

intact_biogridintact_biogrid_opencell

Supporting Publications9

PMID	Title	Related sentences
27821849	Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation.	No related sentences available
36064647	Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells.	No related sentences available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No related sentences available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No related sentences available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No related sentences available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No related sentences available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No related sentences available
40940449	Extracellular vesicle-associated transcriptomic and proteomic biomarkers show in vitro potential for vandetanib treatment monitoring in anaplastic thyroid cancer.	No related sentences available
41307968	Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System.	No related sentences available