Protein detail
EPN1
Epsin-1 (EH domain-binding mitotic phosphoprotein) (EPS-15-interacting protein 1)
Entry name EPN1 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 9 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Epsin-1 (EH domain-binding mitotic phosphoprotein) (EPS-15-interacting protein 1)
Protein Class (2)
Plasma proteinsPredicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Epsin 1
Chromosome
19
Position
55675226-55709858
Supporting publications (n)
9
EVMP confidence score
0.63
Fluorescence & Localization4
Tissue Specificheart muscleCell SpecificDecidual stromal cellsSingle-Nuclei Brain Specificoligodendrocyte
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function (4)
Reactome (7)
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence26
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| EPN1 | CDK1 | P06493 | S | 357 | phosphorylation | phosphoELMKEA | KEA:17570479phosphoELM:10764745KEA:10764745 |
| EPN1 | CDK1 | P06493 | S | 468 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMPPhosphoSite_MIMP | |
| EPN1 | GSK3B | P49841 | S | 357 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EPN1 | Q9Y6I3 | EGFR | P00533 | Yes | No | Yes | WangSIGNORBioGRID | BioGRID:19054389SIGNOR:19054389 |
| EPN1 | Q9Y6I3 | COMPLEX:CHEBI:18348_O94973_P09496_P09497_P53675_P53680_P63010_Q00610_Q96CW1 | Yes | Yes | No | SIGNOR | SIGNOR:24789820 | |
| COMPLEX:O94973_P53680_P63010_Q96CW1 | EPN1 | Q9Y6I3 | Yes | Yes | No | SIGNOR | SIGNOR:15496985 | |
| CDK1 | P06493 | EPN1 | Q9Y6I3 | Yes | Yes | Yes | HPRD_MIMPSIGNORProtMapperdbPTMPhosphoSite_KEAphosphoELM_KEAHPRDWangPhosphoSite_ProtMapperNetworKIN_KEAphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite | phosphoELM:10764745HPRD:10764745PhosphoSite:10764745KEA:10764745SIGNOR:10764745KEA:17570479ProtMapper:10764745dbPTM:10764745 |
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARHGAP31CDC42CDK1DIAPH2EPN1PAK6PLEKHG2TBC1D3F | A6NER0O60879P06493P60953Q2M1Z3Q9H7P9Q9NQU5Q9Y6I3 | 1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC3724 | ||
| AP1B1AP1G1AP1M1AP1M2AP1S1AP1S2AP2B1ASMTLCLINT1CLTBCLTCEPN1GGA2UBC | O43747O95671P09497P0CG48P56377P61966P63010Q00610Q10567Q14677Q9BXS5Q9UJY4Q9Y6I3Q9Y6Q5 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4458 | ||
| EPN1EPN2EPN3 | O95208Q9H201Q9Y6I3 | 0:0:0 | hu.MAP2 | |||
| CCDC25EPN1NDRG2TYMS | P04818Q86WR0Q9UN36Q9Y6I3 | 0:0:0:0 | hu.MAP2 | |||
| EPN1NDRG2TYMS | P04818Q9UN36Q9Y6I3 | 0:0:0 | hu.MAP2 | |||
| EPN1UROD | P06132Q9Y6I3 | 0:0 | hu.MAP | |||
| CCNB1EPN1 | P14635Q9Y6I3 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
Sequence, Structure & Domains15
Sequences
Length
576
Mass
60,293
Sequence
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQSSGEEELQLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIRRGDDLRLQMAIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPVSGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPPVPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9Y6I3-2; Sequence=Displayed; Name=2; IsoId=Q9Y6I3-1; Sequence=VSP_041010, VSP_041011; Name=3; IsoId=Q9Y6I3-3; Sequence=VSP_041011, VSP_041012
Alternative Sequence
1; M -> MGDQSWLWNQAAPGVRSPVFACSVEKGNVPLVLSEHLAHSRDPGSGAVRFLISPEPWASAILGTSGLLASPVLPAALDAVTCQHLPQPSSGSRPISPRIGALCPLLLQPGTM (in isoform 2); 202..226; Missing (in isoform 2 and isoform 3); 393; Missing (in isoform 3)
3D Structural Models
Helix
20..27; 39..47; 51..62; 63..65; 72..86; 90..98; 100..108; 121..134
3D Structure
NMR spectroscopy (1); X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
157..167; Low complexity; 265..296; Low complexity; 297..314; Pro residues; 332..368; Low complexity; 454..468; Pro residues; 557..570; Pro residues
Repeat
274..276; 1; 294..296; 2; 306..308; 3; 319..321; 4; 332..334; 5; 349..351; 6; 367..369; 7; 377..379; 8; 502..504; 1; 518..520; 2; 572..574; 3
Motif
402..411; [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif
Domain (CC)
The NPF repeat domain is involved in EPS15 binding.; DOMAIN: The DPW repeat domain is involved in AP2A2 and clathrin binding.; DOMAIN: The [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif mediates interaction with the AP-2 complex subunit AP2B1..
Domain (FT)
12..144; ENTH; 183..202; UIM 1; 208..227; UIM 2; 233..252; UIM 3
Region
149..185; Disordered; 265..404; Disordered; 274..379; 8 X 3 AA repeats of [ED]-P-W; 448..576; Disordered; 502..574; 3 X 3 AA repeats of N-P-F
Protein Families
Epsin family
Sequence Similarities
Belongs to the epsin family.
Clinical Relevance4
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 27821849 | Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation. | No abstract available |
| 36064647 | Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells. | No abstract available |
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No abstract available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No abstract available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |
| 40940449 | Extracellular vesicle-associated transcriptomic and proteomic biomarkers show in vitro potential for vandetanib treatment monitoring in anaplastic thyroid cancer. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |