Protein detail

XRP2

Protein XRP2

Entry name XRP2	UniProt ID O75695	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein XRP2

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Eye disease

Ensembl

ENSG00000102218

Entrez Gene Symbol

RP2

Gene Synonym (3)

NM23-H10NME10TBCCD2

Gene Description

RP2 activator of ARL3 GTPase

Chromosome

Position

46837043-46882358

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Tissue Specificadrenal glandCell SpecificAdrenal cortex cells

Function & Pathway6

Protein Function (3)

Disease related genes
Predicted intracellular proteins
Human disease related genes:Nervous system diseases:Eye disease

Cellular Component (11)

Page 1 of 2

Molecular Function (5)

Biological Process (3)

Reactome (4)

Mediation Categories

Other mediation

Relations & Evidence32

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No

Protein Complex Composition (26)

26 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
DNPEP ERO1A ERO1B ERP27 P4HB PDIA3 PDIA4 UBC	P07237 P0CG48 P13667 P30101 Q86YB8 Q96DN0 Q96HE7 Q9ULA0	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6767
ASNS CSRP2	P08243 Q16527	0:0	hu.MAP2
APLF PARP1 PARP2 WRN XPC XRCC6	P09874 P12956 Q01831 Q14191 Q8IW19 Q9UGN5	0:0:0:0:0:0	hu.MAP2
APLF PARP2 WRN XRCC6	P12956 Q14191 Q8IW19 Q9UGN5	0:0:0:0	hu.MAP2
CETN2 PARP2 XPC XRCC5	P13010 P41208 Q01831 Q9UGN5	0:0:0:0	hu.MAP
PNLIP PNLIPRP2	P16233 P54317	0:0	hu.MAP2
CALR ERP29	P27797 P30040	2:2	PDB	PDB:5v90
ERP29	P30040	2	PDB	PDB:2qc7
ERP29 GLB1L	P30040 Q6UWU2	0:0	hu.MAP2
ERP29 JPT1	P30040 Q9UK76	0:0	hu.MAP

Page 2 of 3Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	29148239 27894104

Sequence, Structure & Domains12

Sequences

Length

350

Mass

39,641

Sequence

MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

3D Structural Models

Turn

216..218

Helix

155..161; 195..197; 205..207; 246..259; 274..281; 282..287; 289..294; 307..318; 330..348

Beta Strand

39..44; 49..52; 62..66; 71..74; 81..85; 90..104; 106..121; 123..133; 136..139; 141..147; 175..178; 185..188; 235..240; 263..270; 297..304; 324..326

3D Structure

X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

1..10; Basic residues; 11..31; Basic and acidic residues

Domain (FT)

24..179; C-CAP/cofactor C-like

Region

1..31; Disordered

Protein Families

TBCC family

Sequence Similarities

Belongs to the TBCC family.

Clinical Relevance5

Disease Involvement (2)

Disease variantRetinitis pigmentosa

Antibody (2)

HPA000234 HPA000909

Interaction Protein (3)

ENSG00000129353ENSG00000134996ENSG00000138175

Interaction Count

Interaction Dataset (2)

biogrid_bioplexintact_biogrid

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available