Protein detail
OTU1
Ubiquitin thioesterase OTU1 (EC 3.4.19.12) (DUBA-8) (HIV-1-induced protease 7) (HIN-7) (HsHIN7) (OTU domain-containing protein 2)
Entry name OTU1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 8 | Transmembrane count | Protein classification EnzymesPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Ubiquitin thioesterase OTU1 (EC 3.4.19.12) (DUBA-8) (HIV-1-induced protease 7) (HIN-7) (HsHIN7) (OTU domain-containing protein 2)
Protein Class (2)
EnzymesPredicted intracellular proteins
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
DKFZp451J1719DUBA8OTUD2
Gene Description
YOD1 deubiquitinase
Chromosome
1
Position
207043849-207052980
Supporting publications (n)
8
EVMP confidence score
0.50
Fluorescence & Localization2
Tissue Specificbone marrowCell SpecificErythrocyte progenitors
Function & Pathway7
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Hydrolases
Cellular Component (2)
Molecular Function (7)
Biological Process (3)
Reactome (3)
Mediation Categories (2)
Fusion and delivery mediationMetabolism mediation
Relations & Evidence32
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (27)
27 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blottingFlow cytometry | 1 | 38321535 |
Sequence, Structure & Domains14
Sequences
Length
348
Mass
38,322
Sequence
MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQGLSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q5VVQ6-1; Sequence=Displayed; Name=2; IsoId=Q5VVQ6-2; Sequence=VSP_024122
Alternative Sequence
1..61; MFGPAKGRHFGVHPAPGFPGGVSQQAAGTKAGPAGAWPVGSRTDTMWRLRCKAKDGTHVLQ -> METLHIIYSEAKSFTVE (in isoform 2)
3D Structural Models
Turn
194..196; 241..244; 250..252
Helix
138..140; 160..169; 176..178; 179..192; 199..202; 206..213; 222..232; 292..308
Beta Strand
148..151; 215..217; 234..240; 245..249; 256..263; 268..274; 276..280; 285..287
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
1..11; Basic residues
Zinc Finger
318..342; C2H2-type
Domain (CC)
The UBAX-like region mediates the interaction with VCP. According to PubMed:19818707, it corresponds to a UBX domain, which is a hallmark for VCP-associated proteins. However, no canonical UBX is detected by prediction tools such as Pfam or PROSITE.; DOMAIN: The C2H2-type zinc finger mediates specificity for 'Lys-27'-, 'Lys-29'- and 'Lys-33'-linked polyubiquitin chains but not for 'Lys-11'-linked ubiquitin chains. Selectivity for 'Lys-11'-linked ubiquitin chains is provided by recognition of the sequence surrounding 'Lys-11' in ubiquitin. The S2 site region provides specificity for longer 'Lys-11'-linked ubiquitin chains (PubMed:23827681).
Domain (FT)
149..274; OTU
Region
1..39; Disordered; 50..128; UBX-like; 154..160; Cys-loop; 213..223; Variable-loop; 263..267; His-loop; 291..296; S2 site
Clinical Relevance4
Supporting Publications8
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No abstract available |
| 33309826 | Proteomic analysis of extracellular vesicles and conditioned medium from human adipose-derived stem/stromal cells and dermal fibroblasts. | No abstract available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 38607062 | Enrichment, Characterization, and Proteomic Profiling of Small Extracellular Vesicles Derived from Human Limbal Mesenchymal Stromal Cells and Melanocytes. | No abstract available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No abstract available |