Protein detail
PDGFC
Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC receptor-binding form)]
Entry name PDGFC | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 9 | Transmembrane count | Protein classification Predicted secreted proteinsRAS pathway related proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC receptor-binding form)]
Protein Class (2)
Predicted secreted proteinsRAS pathway related proteins
Protein Function (2)
- Predicted secreted proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
falloteinSCDGF
Gene Description
Platelet derived growth factor C
Chromosome
4
Position
156760454-156971799
Supporting publications (n)
9
EVMP confidence score
0.63
Fluorescence & Localization4
Cell SpecificEpididymal principal cellsBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway7
Protein Function (2)
- Predicted secreted proteins
- RAS pathway related proteins
Cellular Component (9)
Molecular Function (4)
Biological Process (3)
KEGG (14)
- hsa01521 EGFR tyrosine kinase inhibitor resistance
- KEGG:hsa04010 MAPK signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04540 Gap junction
Page 1 of 2
Mediation Categories (2)
Metabolism mediationReceptor-signaling mediation
Relations & Evidence58
Ligand-Receptor Signaling (49)
49 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | CellPhoneDB | No | No | Yes | No | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | No | No |
| secreted | secreted | Cellinker | No | No | Yes | No | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | No | No |
| secreted | secreted | UniProt_location | No | No | Yes | No | No |
| secreted | secreted | HPA_secretome | No | No | Yes | No | No |
| secreted | secreted | connectomeDB2020 | No | No | Yes | No | No |
| secreted | secreted | Baccin2019 | No | No | Yes | No | No |
Regulatory Interaction Network (2)
2 records.
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Platelet-derived growth factor CC complex | PDGFC | Q9NRA1 | 1 | ComplexPortal | intact:EBI-9079474 | 1475529215207811 |
| CREB3OGTPDGFC | O15294O43889Q9NRA1 | 0:0:0 | hu.MAP2 | |||
| CREB3DPY30HCFC1PDGFCTHAP11THAP2 | O43889P51610Q96EK4Q9C005Q9H0W7Q9NRA1 | 0:0:0:0:0:0 | hu.MAP2 | |||
| BLTP3ACREB3CREB3L2PDGFC | O43889Q6BDS2Q70SY1Q9NRA1 | 0:0:0:0 | hu.MAP | |||
| BLTP3ACREB3PDGFC | O43889Q6BDS2Q9NRA1 | 0:0:0 | hu.MAP2 | |||
| CREB3PDGFC | O43889Q9NRA1 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains8
Sequences
Length
345
Mass
39,029
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9NRA1-1; Sequence=Displayed; Name=2; IsoId=Q9NRA1-2; Sequence=VSP_034703; Name=3; IsoId=Q9NRA1-3; Sequence=VSP_034701, VSP_034702; Name=4; IsoId=Q9NRA1-4; Sequence=VSP_047606
Alternative Sequence
1..163; Missing (in isoform 4); 155..167; GFCIHYNIVMPQF -> SNRGGKIIQLHTS (in isoform 3); 168..345; Missing (in isoform 3); 244..306; Missing (in isoform 2)
Domain & Motif Annotations
Domain (FT)
46..163; CUB
Protein Families
PDGF/VEGF growth factor family
Sequence Similarities
Belongs to the PDGF/VEGF growth factor family.
Clinical Relevance5
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 28102751 | Extracellular vesicles from activated platelets: a semiquantitative cryo-electron microscopy and immuno-gold labeling study. | According to the current model, EVs shed from the plasma membrane, often called microvesicles, expose phosphatidylserine (PS) and range in size from 100 nm to 1 µm, while EVs originating from endosomal multi-vesicular bodies, called exosomes, contain tetraspanin proteins, including CD63, and range in size from 50 to 100 nm. |
| 28823103 | Bariatric Surgery Is Accompanied by Changes in Extracellular Vesicle-Associated and Plasma Fatty Acid Binding Protein 4. | EV origin (CD9: exosome; CD41: platelet; CD235a: erythrocyte; CD11b: leukocyte; CD144: endothelial), cytokine (interferon γ, interleukin-6, TNF-α) and adipocyte marker (adiponectin, FABP4, PPARγ) expression was measured by time-resolved fluorescence immunoassay. |
| 29845758 | Low cardiorespiratory fitness is associated with higher extracellular vesicle counts in obese adults. | Extracellular vesicles (EVs) are a novel target of CVD, however, it remains unknown if obese individuals with very poor fitness (VPF) have elevated EVs versus people with poor fitness (PF). |
| 32341357 | CD41-deficient exosomes from non-traumatic femoral head necrosis tissues impair osteogenic differentiation and migration of mesenchymal stem cells. | Taken together, our study results revealed that in the progress of ONFH, exosomes from the pathological bone brought about the failure of MSCs repairing the necrotic bone for lack of some critical proteins, like integrin CD41, and prompted the progression of experimentally induced ONFH-like status in the rat. |
| 33345458 | Platelet-derived extracellular vesicles are increased in sera of Alzheimer's disease patients, as revealed by Tim4-based assays. | LC-MS/MS analysis identified a protein band precipitated by rPALa as CD61, a marker of platelet-derived exosomes (P-Exo). |
| 34224189 | Amphibian thrombocyte-derived extracellular vesicles, including microRNAs, induce angiogenesis-related genes in endothelial cells. | Here, we report the finding that thrombocytes produce integrin alpha IIb (CD41)-positive extracellular vesicles (EVs), which include microRNAs (miRs). |
| 34979484 | Plasma-derived extracellular vesicles from myocardial infarction patients inhibits tumor necrosis factor-alpha induced cardiac cell death. | No abstract available |
| 35350978 | CD63-positive extracellular vesicles are potential diagnostic biomarkers of pancreatic ductal adenocarcinoma. | No abstract available |
| 35811733 | Circulating Small Extracellular Vesicles Profiling and Thrombin Generation as Potential Markers of Thrombotic Risk in Glioma Patients. | This study aimed to evaluate the relative abundance of extracellular vesicles (EVs) and thrombin generation (TG) in combination with standard laboratory tests in patients with newly diagnosed GM as potential prognostic markers in VTE. |