Protein detail
PDGFC
Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC receptor-binding form)]
Protein symbol PDGFC | UniProt ID | EVMP score 0.63 |
Frequency 9 | Transmembrane count | Protein classification Predicted secreted proteinsRAS pathway related proteins |
Basic Information
Protein Names
Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC receptor-binding form)]
Protein Class
Predicted secreted proteinsRAS pathway related proteins
Protein Function
- Predicted secreted proteins
- RAS pathway related proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
falloteinSCDGF
Gene Description
Platelet derived growth factor C
Chromosome
4
Position
156760454-156971799
Frequency
9
EVMP Score
0.63
Fluorescence & Localization
Cell SpecificEpididymal principal cellsBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function
- Predicted secreted proteins
- RAS pathway related proteins
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa01521 EGFR tyrosine kinase inhibitor resistance
- KEGG:hsa04010 MAPK signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04540 Gap junction
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa05215 Prostate cancer
- KEGG:hsa05218 Melanoma
- KEGG:hsa05231 Choline metabolism in cancer
Mediation Categories
Metabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
49 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | Matrisome | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
| ligand | ligand | talklr | Yes | No | Yes | No | No |
| ligand | ligand | Cellinker | Yes | No | Yes | No | No |
| ligand | ligand | scConnect | Yes | No | Yes | No | No |
| ligand | ligand | connectomeDB2020 | Yes | No | Yes | No | No |
| ligand | ligand | Matrisome | Yes | No | Yes | No | No |
| ligand | ligand | CellCall | Yes | No | Yes | No | No |
| growth_factor | ligand | UniProt_keyword | Yes | No | Yes | No | No |
| ligand | ligand | iTALK | Yes | No | Yes | No | No |
Regulatory Interaction Network
2 records.
Protein Complex Composition
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Platelet-derived growth factor CC complex | PDGFC | Q9NRA1 | 1 | ComplexPortal | intact:EBI-9079474 | 1475529215207811 |
| CREB3OGTPDGFC | O15294O43889Q9NRA1 | 0:0:0 | hu.MAP2 | |||
| CREB3DPY30HCFC1PDGFCTHAP11THAP2 | O43889P51610Q96EK4Q9C005Q9H0W7Q9NRA1 | 0:0:0:0:0:0 | hu.MAP2 | |||
| BLTP3ACREB3CREB3L2PDGFC | O43889Q6BDS2Q70SY1Q9NRA1 | 0:0:0:0 | hu.MAP | |||
| BLTP3ACREB3PDGFC | O43889Q6BDS2Q9NRA1 | 0:0:0 | hu.MAP2 | |||
| CREB3PDGFC | O43889Q9NRA1 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
345
Mass
39,029
Sequence
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q9NRA1-1; Sequence=Displayed; Name=2; IsoId=Q9NRA1-2; Sequence=VSP_034703; Name=3; IsoId=Q9NRA1-3; Sequence=VSP_034701, VSP_034702; Name=4; IsoId=Q9NRA1-4; Sequence=VSP_047606
Alternative Sequence
1..163; Missing (in isoform 4); 155..167; GFCIHYNIVMPQF -> SNRGGKIIQLHTS (in isoform 3); 168..345; Missing (in isoform 3); 244..306; Missing (in isoform 2)
3D Structural Models
Domain & Motif Annotations
Domain (FT)
46..163; CUB
Protein Families
PDGF/VEGF growth factor family
Sequence Similarities
Belongs to the PDGF/VEGF growth factor family.